磷酸化 ERK1/2 (Thr202/Tyr204) 抗体 - AF1015 - Phospho-ERK1/2 (Thr202/Tyr204) Antibody

	单价	规格
	￥1200	50ul
	￥2200	100ul
	￥2800	200ul

产品信息

别名:Expand▼

ERK 1; ERK; ERK-1; ERK1; ERT 2; ERT2; Extracellular Signal Regulated Kinase 1; Extracellular signal related kinase 1; Extracellular signal-regulated kinase 1; HGNC6877; HS44KDAP; HUMKER1A; Insulin Stimulated MAP2 Kinase; Insulin-stimulated MAP2 kinase; MAP kinase 1; MAP kinase 3; MAP Kinase; MAP kinase isoform p44; MAPK 1; MAPK 3; MAPK; MAPK1; Mapk3; MGC20180; Microtubule Associated Protein 2 Kinase; Microtubule-associated protein 2 kinase; Mitogen Activated Protein Kinase 3; Mitogen-activated protein kinase 1; Mitogen-activated protein kinase 3; MK03_HUMAN; OTTHUMP00000174538; OTTHUMP00000174541; p44 ERK1; p44 MAPK; p44-ERK1; p44-MAPK; P44ERK1; P44MAPK; PRKM 3; PRKM3; Protein Kinase Mitogen Activated 3; ERK 2; ERK; ERK-2; ERT1; Extracellular Signal Regulated Kinase 2; Extracellular signal-regulated kinase 2; MAP kinase 1; MAP kinase 2; MAP kinase isoform p42; MAPK 1; MAPK 2; Mapk1; MAPK2; Mitogen-activated protein kinase 1; Mitogen-activated protein kinase 2; MK01_HUMAN; P38; P40; P41; p42-MAPK; P42MAPK; PRKM1; PRKM2; protein kinase, mitogen-activated, 1; protein kinase, mitogen-activated, 2; protein tyrosine kinase ERK2;

应用:

WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:200, ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.

反应性:

Human, Mouse, Rat

预测反应:

Pig(100%), Zebrafish(100%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%)

来源:

Rabbit

克隆性:

Polyclonal

纯化:

The antibody is from purified rabbit serum by affinity purification via sequential chromatography on phospho-peptide and non-phospho-peptide affinity columns.

特异性:

Phospho-ERK1/2 (Thr202/Tyr204) Antibody detects endogenous levels of ERK1/2 only when phosphorylated at Threonine 202/Tyrosine 204.

RRID:

AB_2834432
引用格式: Affinity Biosciences Cat# AF1015, RRID:AB_2834432.

形式:

Liquid

浓度:

1mg/ml

保存条件:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.Store at -20 °C.Stable for 12 months from date of receipt.

免疫原

Immunogen:

A synthesized peptide derived from human ERK1/2 around the phosphorylation site of Thr202/Tyr204.

Uniprot:

>>Visit The Human Protein Atlas

Gene ID:

Gene Name:

MAPK3,MAPK1

Molecular Weight:

Observed Mol.Wt.: 42,44kD.
Predicted Mol.Wt.: 43kDa,41kDa(Calculated)..

Subcellular Location:

Nucleus.

Description:

Sequence:

P27361 MK03_HUMAN:
Protein BLAST With
NCBI/
ExPASy/
Uniprot

MAAAAAQGGGGGEPRRTEGVGPGVPGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVYIVQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERLKELIFQETARFQPGVLEAP

P28482 MK01_HUMAN:
Protein BLAST With
NCBI/
ExPASy/
Uniprot

MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS

Function:

Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway. MAPK1/ERK2 and MAPK3/ERK1 are the 2 MAPKs which play an important role in the MAPK/ERK cascade. They participate also in a signaling cascade initiated by activated KIT and KITLG/SCF. Depending on the cellular context, the MAPK/ERK cascade mediates diverse biological functions such as cell growth, adhesion, survival and differentiation through the regulation of transcription, translation, cytoskeletal rearrangements. The MAPK/ERK cascade plays also a role in initiation and regulation of meiosis, mitosis, and postmitotic functions in differentiated cells by phosphorylating a number of transcription factors. About 160 substrates have already been discovered for ERKs. Many of these substrates are localized in the nucleus, and seem to participate in the regulation of transcription upon stimulation. However, other substrates are found in the cytosol as well as in other cellular organelles, and those are responsible for processes such as translation, mitosis and apoptosis. Moreover, the MAPK/ERK cascade is also involved in the regulation of the endosomal dynamics, including lysosome processing and endosome cycling through the perinuclear recycling compartment (PNRC); as well as in the fragmentation of the Golgi apparatus during mitosis. The substrates include transcription factors (such as ATF2, BCL6, ELK1, ERF, FOS, HSF4 or SPZ1), cytoskeletal elements (such as CANX, CTTN, GJA1, MAP2, MAPT, PXN, SORBS3 or STMN1), regulators of apoptosis (such as BAD, BTG2, CASP9, DAPK1, IER3, MCL1 or PPARG), regulators of translation (such as EIF4EBP1) and a variety of other signaling-related molecules (like ARHGEF2, FRS2 or GRB10). Protein kinases (such as RAF1, RPS6KA1/RSK1, RPS6KA3/RSK2, RPS6KA2/RSK3, RPS6KA6/RSK4, SYK, MKNK1/MNK1, MKNK2/MNK2, RPS6KA5/MSK1, RPS6KA4/MSK2, MAPKAPK3 or MAPKAPK5) and phosphatases (such as DUSP1, DUSP4, DUSP6 or DUSP16) are other substrates which enable the propagation the MAPK/ERK signal to additional cytosolic and nuclear targets, thereby extending the specificity of the cascade.

Post-translational Modifications:

Phosphorylated upon KIT and FLT3 signaling (By similarity). Dually phosphorylated on Thr-202 and Tyr-204, which activates the enzyme. Ligand-activated ALK induces tyrosine phosphorylation. Dephosphorylated by PTPRJ at Tyr-204.

Subcellular Location:

Cytoplasm. Nucleus. Membrane>Caveola.
Note: Autophosphorylation at Thr-207 promotes nuclear localization.

Subunit Structure:

Binds both upstream activators and downstream substrates in multimolecular complexes. Found in a complex with at least BRAF, HRAS, MAP2K1/MEK1, MAPK3 and RGS14 (By similarity). Interacts with ADAM15, ARRB2, CANX, DAPK1 (via death domain), HSF4, IER3, MAP2K1/MEK1, MORG1, NISCH, and SGK1. Interacts with PEA15 and MKNK2 (By similarity). MKNK2 isoform 1 binding prevents from dephosphorylation and inactivation (By similarity). Interacts with TPR. Interacts with CDKN2AIP. Interacts with HSF1 (via D domain and preferentially with hyperphosphorylated form); this interaction occurs upon heat shock. Interacts with CAVIN4 (By similarity).

(Microbial infection) Binds to HIV-1 Nef through its SH3 domain. This interaction inhibits its tyrosine-kinase activity.

Similarity:

The TXY motif contains the threonine and tyrosine residues whose phosphorylation activates the MAP kinases.

Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily.

Function:

Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway. MAPK1/ERK2 and MAPK3/ERK1 are the 2 MAPKs which play an important role in the MAPK/ERK cascade. They participate also in a signaling cascade initiated by activated KIT and KITLG/SCF. Depending on the cellular context, the MAPK/ERK cascade mediates diverse biological functions such as cell growth, adhesion, survival and differentiation through the regulation of transcription, translation, cytoskeletal rearrangements. The MAPK/ERK cascade plays also a role in initiation and regulation of meiosis, mitosis, and postmitotic functions in differentiated cells by phosphorylating a number of transcription factors. About 160 substrates have already been discovered for ERKs. Many of these substrates are localized in the nucleus, and seem to participate in the regulation of transcription upon stimulation. However, other substrates are found in the cytosol as well as in other cellular organelles, and those are responsible for processes such as translation, mitosis and apoptosis. Moreover, the MAPK/ERK cascade is also involved in the regulation of the endosomal dynamics, including lysosome processing and endosome cycling through the perinuclear recycling compartment (PNRC); as well as in the fragmentation of the Golgi apparatus during mitosis. The substrates include transcription factors (such as ATF2, BCL6, ELK1, ERF, FOS, HSF4 or SPZ1), cytoskeletal elements (such as CANX, CTTN, GJA1, MAP2, MAPT, PXN, SORBS3 or STMN1), regulators of apoptosis (such as BAD, BTG2, CASP9, DAPK1, IER3, MCL1 or PPARG), regulators of translation (such as EIF4EBP1) and a variety of other signaling-related molecules (like ARHGEF2, DCC, FRS2 or GRB10). Protein kinases (such as RAF1, RPS6KA1/RSK1, RPS6KA3/RSK2, RPS6KA2/RSK3, RPS6KA6/RSK4, SYK, MKNK1/MNK1, MKNK2/MNK2, RPS6KA5/MSK1, RPS6KA4/MSK2, MAPKAPK3 or MAPKAPK5) and phosphatases (such as DUSP1, DUSP4, DUSP6 or DUSP16) are other substrates which enable the propagation the MAPK/ERK signal to additional cytosolic and nuclear targets, thereby extending the specificity of the cascade. Mediates phosphorylation of TPR in respons to EGF stimulation. May play a role in the spindle assembly checkpoint. Phosphorylates PML and promotes its interaction with PIN1, leading to PML degradation. Phosphorylates CDK2AP2 (By similarity).

Acts as a transcriptional repressor. Binds to a [GC]AAA[GC] consensus sequence. Repress the expression of interferon gamma-induced genes. Seems to bind to the promoter of CCL5, DMP1, IFIH1, IFITM1, IRF7, IRF9, LAMP3, OAS1, OAS2, OAS3 and STAT1. Transcriptional activity is independent of kinase activity.

Post-translational Modifications:

Phosphorylated upon KIT and FLT3 signaling (By similarity). Dually phosphorylated on Thr-185 and Tyr-187, which activates the enzyme. Undergoes regulatory phosphorylation on additional residues such as Ser-246 and Ser-248 in the kinase insert domain (KID) These phosphorylations, which are probably mediated by more than one kinase, are important for binding of MAPK1/ERK2 to importin-7 (IPO7) and its nuclear translocation. In addition, autophosphorylation of Thr-190 was shown to affect the subcellular localization of MAPK1/ERK2 as well. Ligand-activated ALK induces tyrosine phosphorylation. Dephosphorylated by PTPRJ at Tyr-187. Phosphorylation on Ser-29 by SGK1 results in its activation by enhancing its interaction with MAP2K1/MEK1 and MAP2K2/MEK2. DUSP3 and DUSP6 dephosphorylate specifically MAPK1/ERK2 and MAPK3/ERK1 whereas DUSP9 dephosphorylates a broader range of MAPKs. Dephosphorylated by DUSP1 at Thr-185 and Tyr-187.

ISGylated.

Subcellular Location:

Cytoplasm>Cytoskeleton>Spindle. Nucleus. Cytoplasm>Cytoskeleton>Microtubule organizing center>Centrosome. Cytoplasm. Membrane>Caveola.
Note: Associated with the spindle during prometaphase and metaphase (By similarity). PEA15-binding and phosphorylated DAPK1 promote its cytoplasmic retention. Phosphorylation at Ser- 246 and Ser-248 as well as autophosphorylation at Thr-190 promote nuclear localization.

Subunit Structure:

Binds both upstream activators and downstream substrates in multimolecular complexes. This interaction inhibits its tyrosine-kinase activity. Interacts with ADAM15, ARHGEF2, ARRB2, DAPK1 (via death domain), HSF4, IER3, IPO7, DUSP6, NISCH, SGK1, and isoform 1 of NEK2. Interacts (phosphorylated form) with CAV2 ('Tyr-19'-phosphorylated form); the interaction, promoted by insulin, leads to nuclear location and MAPK1 activation. Interacts with MORG1, PEA15 and MKNK2 (By similarity). MKNK2 isoform 1 binding prevents from dephosphorylation and inactivation (By similarity). Interacts with DCC (By similarity). The phosphorylated form interacts with PML (isoform PML-4). Interacts with STYX. Interacts with CDK2AP2. Interacts with CAVIN4 (By similarity). Interacts with DUSP7; the interaction enhances DUSP7 phosphatase activity.

(Microbial infection) Interacts with HIV-1 Nef through its SH3 domain.

Similarity:

研究领域

Research Fields:

· Cellular Processes > Cell growth and death > Oocyte meiosis.(View pathway)
· Cellular Processes > Transport and catabolism > Autophagy - animal.(View pathway)
· Cellular Processes > Cell growth and death > Apoptosis.(View pathway)
· Cellular Processes > Cell growth and death > Cellular senescence.(View pathway)
· Cellular Processes > Cellular community - eukaryotes > Focal adhesion.(View pathway)
· Cellular Processes > Cellular community - eukaryotes > Adherens junction.(View pathway)
· Cellular Processes > Cellular community - eukaryotes > Gap junction.(View pathway)
· Cellular Processes > Cellular community - eukaryotes > Signaling pathways regulating pluripotency of stem cells.(View pathway)
· Cellular Processes > Cell motility > Regulation of actin cytoskeleton.(View pathway)
· Environmental Information Processing > Signal transduction > MAPK signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > ErbB signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > Ras signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > Rap1 signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > cGMP-PKG signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > cAMP signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > HIF-1 signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > FoxO signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > Sphingolipid signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > Phospholipase D signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > mTOR signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > TGF-beta signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > Apelin signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > TNF signaling pathway.(View pathway)
· Human Diseases > Drug resistance: Antineoplastic > EGFR tyrosine kinase inhibitor resistance.
· Human Diseases > Drug resistance: Antineoplastic > Endocrine resistance.
· Human Diseases > Drug resistance: Antineoplastic > Platinum drug resistance.
· Human Diseases > Endocrine and metabolic diseases > Type II diabetes mellitus.
· Human Diseases > Neurodegenerative diseases > Alzheimer's disease.(View pathway)
· Human Diseases > Neurodegenerative diseases > Prion diseases.
· Human Diseases > Substance dependence > Alcoholism.
· Human Diseases > Infectious diseases: Bacterial > Shigellosis.
· Human Diseases > Infectious diseases: Bacterial > Salmonella infection.
· Human Diseases > Infectious diseases: Bacterial > Pertussis.
· Human Diseases > Infectious diseases: Parasitic > Leishmaniasis.
· Human Diseases > Infectious diseases: Parasitic > Chagas disease (American trypanosomiasis).
· Human Diseases > Infectious diseases: Parasitic > Toxoplasmosis.
· Human Diseases > Infectious diseases: Bacterial > Tuberculosis.
· Human Diseases > Infectious diseases: Viral > Hepatitis C.
· Human Diseases > Infectious diseases: Viral > Hepatitis B.
· Human Diseases > Infectious diseases: Viral > Influenza A.
· Human Diseases > Infectious diseases: Viral > Human papillomavirus infection.
· Human Diseases > Cancers: Overview > Pathways in cancer.(View pathway)
· Human Diseases > Cancers: Overview > Viral carcinogenesis.
· Human Diseases > Cancers: Overview > Proteoglycans in cancer.
· Human Diseases > Cancers: Specific types > Colorectal cancer.(View pathway)
· Human Diseases > Cancers: Specific types > Renal cell carcinoma.(View pathway)
· Human Diseases > Cancers: Specific types > Pancreatic cancer.(View pathway)
· Human Diseases > Cancers: Specific types > Endometrial cancer.(View pathway)
· Human Diseases > Cancers: Specific types > Glioma.(View pathway)
· Human Diseases > Cancers: Specific types > Prostate cancer.(View pathway)
· Human Diseases > Cancers: Specific types > Thyroid cancer.(View pathway)
· Human Diseases > Cancers: Specific types > Melanoma.(View pathway)
· Human Diseases > Cancers: Specific types > Bladder cancer.(View pathway)
· Human Diseases > Cancers: Specific types > Chronic myeloid leukemia.(View pathway)
· Human Diseases > Cancers: Specific types > Acute myeloid leukemia.(View pathway)
· Human Diseases > Cancers: Specific types > Non-small cell lung cancer.(View pathway)
· Human Diseases > Cancers: Specific types > Breast cancer.(View pathway)
· Human Diseases > Cancers: Specific types > Hepatocellular carcinoma.(View pathway)
· Human Diseases > Cancers: Specific types > Gastric cancer.(View pathway)
· Human Diseases > Cancers: Overview > Central carbon metabolism in cancer.(View pathway)
· Human Diseases > Cancers: Overview > Choline metabolism in cancer.(View pathway)
· Organismal Systems > Immune system > Chemokine signaling pathway.(View pathway)
· Organismal Systems > Circulatory system > Adrenergic signaling in cardiomyocytes.(View pathway)
· Organismal Systems > Circulatory system > Vascular smooth muscle contraction.(View pathway)
· Organismal Systems > Development > Axon guidance.(View pathway)
· Organismal Systems > Development > Osteoclast differentiation.(View pathway)
· Organismal Systems > Immune system > Platelet activation.(View pathway)
· Organismal Systems > Immune system > Toll-like receptor signaling pathway.(View pathway)
· Organismal Systems > Immune system > NOD-like receptor signaling pathway.(View pathway)
· Organismal Systems > Immune system > Natural killer cell mediated cytotoxicity.(View pathway)
· Organismal Systems > Immune system > IL-17 signaling pathway.(View pathway)
· Organismal Systems > Immune system > Th1 and Th2 cell differentiation.(View pathway)
· Organismal Systems > Immune system > Th17 cell differentiation.(View pathway)
· Organismal Systems > Immune system > T cell receptor signaling pathway.(View pathway)
· Organismal Systems > Immune system > B cell receptor signaling pathway.(View pathway)
· Organismal Systems > Immune system > Fc epsilon RI signaling pathway.(View pathway)
· Organismal Systems > Immune system > Fc gamma R-mediated phagocytosis.(View pathway)
· Organismal Systems > Environmental adaptation > Circadian entrainment.
· Organismal Systems > Nervous system > Long-term potentiation.
· Organismal Systems > Nervous system > Neurotrophin signaling pathway.(View pathway)
· Organismal Systems > Nervous system > Retrograde endocannabinoid signaling.(View pathway)
· Organismal Systems > Nervous system > Glutamatergic synapse.
· Organismal Systems > Nervous system > Cholinergic synapse.
· Organismal Systems > Nervous system > Serotonergic synapse.
· Organismal Systems > Nervous system > Long-term depression.
· Organismal Systems > Endocrine system > Insulin signaling pathway.(View pathway)
· Organismal Systems > Endocrine system > Progesterone-mediated oocyte maturation.
· Organismal Systems > Endocrine system > Estrogen signaling pathway.(View pathway)
· Organismal Systems > Endocrine system > Melanogenesis.
· Organismal Systems > Endocrine system > Prolactin signaling pathway.(View pathway)
· Organismal Systems > Endocrine system > Thyroid hormone signaling pathway.(View pathway)
· Organismal Systems > Endocrine system > Oxytocin signaling pathway.
· Organismal Systems > Endocrine system > Relaxin signaling pathway.
· Organismal Systems > Excretory system > Aldosterone-regulated sodium reabsorption.

Peptide-ELISA

ELISA analysis of AF1015 showing specificity to Phospho-ERK1/2 (Thr202/Tyr204) Blocking Peptide peptide. Peptides concentration: 1ug/ml.
P-peptide: phospho-peptide; N-peptide: non-phospho-peptide.

Reference Citations:

1). Zhou B;Yan J;Guo L;Zhang B;Liu S;Yu M;Chen Z;Zhang K;Zhang W;Li X;Xu Y;Xiao Y;Zhou J;Fan J;Hung MC;Li H;Ye Q; et al. Hepatoma cell-intrinsic TLR9 activation induces immune escape through PD-L1 upregulation in hepatocellular carcinoma. Theranostics 2020 May 17;10(14):6530-6543. (PubMed: 32483468) [IF=8.579]

2). Lin F et al. GTSE1 is involved in breast cancer progression in p53 mutation-dependent manner. J Exp Clin Cancer Res 2019 Apr 8;38(1):152 (PubMed: 30961661) [IF=7.068]

3). Tao Y;Zhang J;Chen L;Liu X;Yao M;Zhang H; et al. LncRNA CD27-AS1 promotes acute myeloid leukemia progression through the miR-224-5p/PBX3 signaling circuit. Cell Death Dis 2021 May 18;12(6):510. (PubMed: 34006845) [IF=6.304]

4). Jia C;Zhuge Y;Zhang S;Ni C;Wang L;Wu R;Niu C;Wen Z;Rong X;Qiu H;Chu M; et al. IL-37b alleviates endothelial cell apoptosis and inflammation in Kawasaki disease through IL-1R8 pathway. Cell Death Dis 2021 Jun 3;12(6):575. (PubMed: 34083516) [IF=6.304]

5). Liu Y et al. LncRNA-TCONS_00034812 in cell proliferation and apoptosis of pulmonary artery smooth muscle cells and its mechanism. J Cell Physiol 2018 Jun;233(6):4801-4814 (PubMed: 29150946) [IF=5.546]

6). Huang WL;Abudureheman T;Xia J;Chu L;Zhou H;Zheng WW;Zhou N;Shi RY;Li MH;Zhu JM;Qing K;Ji C;Liang KW;Guo S;Yin G;Duan CW; et al. CDK9 Inhibitor Induces the Apoptosis of B-Cell Acute Lymphocytic Leukemia by Inhibiting c-Myc-Mediated Glycolytic Metabolism. Front Cell Dev Biol 2021 Mar 4;9:641271. (PubMed: 33748130) [IF=5.201]

7). Yang D et al. Separation, purification, structural analysis and immune-enhancing activity of sulfated polysaccharide isolated from sea cucumber viscera. Int J Biol Macromol 2019 Nov 9 (PubMed: 31712137) [IF=5.162]

8). Wu Z et al. In vitro and in vivo anti-Listeria effect of Succinoglycan Riclin through regulating MAPK/IL-6 axis and metabolic profiling. Int J Biol Macromol 2020 Feb 11 (PubMed: 32057883) [IF=5.162]

9). Zheng CQ;Fan HX;Li XX;Li JJ;Sheng S;Zhang F; et al. Resveratrol alleviates levodopa-induced dyskinesia in rats. Front Immunol 2021 Jun 25;12:683577. (PubMed: 34248967) [IF=5.085]

10). Liang Y;Chen G;Zhang F;Yang X;Chen Y;Duan Y;Yu M;Zhang S;Han J; et al. Procyanidin B2 Reduces Vascular Calcification through Inactivation of ERK1/2-RUNX2 Pathway. Antioxidants (Basel) 2021 Jun 5;10(6):916. (PubMed: 34198832) [IF=5.014]

11). Du P;Hu T;An Z;Li P;Liu L; et al. In vitro and in vivo synergistic efficacy of ceritinib combined with programmed cell death ligand‐1 inhibitor in anaplastic lymphoma kinase‐rearranged non‐small‐cell lung cancer. Cancer Sci 2020 Jun;111(6):1887-1898. (PubMed: 32227409) [IF=4.966]

12). Xue M;Shi Y;Pang A;Men L;Hu Y;Zhou P;Long G;Tian X;Wang R;Zhao Y;Liao X;Shen Y;Cui Y; et al. Corin plays a protective role via upregulating MAPK and downregulating eNOS in diabetic nephropathy endothelial dysfunction. FASEB J 2020 Jan;34(1):95-106. (PubMed: 31914697) [IF=4.966]

13). Lin H et al. Overcoming Taxol-resistance in A549 Cells: A Comprehensive Strategy of Targeting P-gp transporter, AKT/ERK Pathways, and Cytochrome P450 Enzyme CYP1B1 by 4-hydroxyemodin. Biochem Pharmacol 2019 Nov 26:113733 (PubMed: 31783010) [IF=4.960]

14). Li X;Yu H;Liang L;Bi Z;Wang Y;Gao S;Wang M;Li H;Miao Y;Deng R;Ma L;Luan J;Li S;Liu M;Lin J;Zhou H;Yang C; et al. Myricetin ameliorates bleomycin-induced pulmonary fibrosis in mice by inhibiting TGF-β signaling via targeting HSP90β. Biochem Pharmacol 2020 Jun 11;114097. (PubMed: 32535102) [IF=4.960]

15). Wang X;Tu J;Jiang J;Zhang Q;Liu Q;Körner H;Wu J;Wu H;Wei W; et al. Angiotensin II Type 2 Receptor Modulates Synovial Macrophage Polarization by Inhibiting GRK2 Membrane Translocation in a Rat Model of Collagen-Induced Arthritis. J Immunol 2020 Nov 4;ji2000561. (PubMed: 33148713) [IF=4.886]

16). Meng P et al. Arsenite induces testicular oxidative stress in vivo and in vitro leading to ferroptosis. Ecotoxicol Environ Saf 2020 Mar 6;194:110360 (PubMed: 32151864) [IF=4.872]

17). Kang Y et al. Intermedin in Paraventricular Nucleus Attenuates Ang II-Induced Sympathoexcitation through the Inhibition of NADPH Oxidase-Dependent ROS Generation in Obese Rats with Hypertension. Int J Mol Sci 2019 Aug 28;20(17) (PubMed: 31466304) [IF=4.556]

18). Sumi K;Sakuda M;Munakata K;Nakamura K;Ashida K; et al. α-Hydroxyisocaproic Acid Decreases Protein Synthesis but Attenuates TNFα/IFNγ Co-Exposure-Induced Protein Degradation and Myotube Atrophy via Suppression of iNOS and IL-6 in Murine C2C12 Myotube. Nutrients 2021 Jul 13;13(7):2391. (PubMed: 34371902) [IF=4.546]

19). Liu X;Gu Y;Bian Y;Cai D;Li Y;Zhao Y;Zhang Z;Xue M;Zhang L; et al. Honokiol induces paraptosis-like cell death of acute promyelocytic leukemia via mTOR & MAPK signaling pathways activation. Apoptosis 2021 Feb 7. (PubMed: 33550458) [IF=4.543]

20). Huang Z;Wang S;Wei H;Chen H;Shen R;Lin R;Wang X;Lan W;Lin R;Lin J; et al. Inhibition of BUB1 suppresses tumorigenesis of osteosarcoma via blocking of PI3K/Akt and ERK pathways. J Cell Mol Med 2021 Aug 1. (PubMed: 34337852) [IF=4.486]

21). Liu Y;Nie X;Zhu J;Wang T;Li Y;Wang Q;Sun Z; et al. NDUFA4L2 in smooth muscle promotes vascular remodeling in hypoxic pulmonary arterial hypertension. J Cell Mol Med 2020 Dec 19;25(2):1221-1237. (PubMed: 33340241) [IF=4.486]

22). Xie J et al. 5-aminolevulinic acid photodynamic therapy reduces HPV viral load via autophagy and apoptosis by modulating Ras/Raf/MEK/ERK and PI3K/AKT pathways in HeLa cells. J Photochem Photobiol B 2019 May;194:46-55 (PubMed: 30925276) [IF=4.383]

23). Fan H et al. The in vitro and in vivo anti-inflammatory effect of osthole, the major natural coumarin from Cnidium monnieri (L.) Cuss, via the blocking of the activation of the NF-κB and MAPK/p38 pathways. Phytomedicine 2019 Feb 18;58:152864 (PubMed: 30878874) [IF=4.268]

24). Su L et al. Pannexin 1 mediates ferroptosis that contributes to renal ischemia/reperfusion injury. J Biol Chem 2019 Dec 13;294(50):19395-19404 (PubMed: 31694915) [IF=4.238]

25). Lu G et al. Inhibition of the cyclophilin A-CD147 interaction attenuates right ventricular injury and dysfunction after acute pulmonary embolism in rats. J Biol Chem 2018 Aug 3;293(31):12199-12208 (PubMed: 29914983) [IF=4.238]

26). Lu G et al. Inhibition of the cyclophilin A-CD147 interaction attenuates right ventricular injury and dysfunction after acute pulmonary embolism in rats. J Biol Chem 2018 Aug 3;293(31):12199-12208 (PubMed: 29914983) [IF=4.238]

27). Peng J et al. miR-221 negatively regulates inflammation and insulin sensitivity in white adipose tissue by repression of sirtuin-1 (SIRT1). J Cell Biochem 2018 Aug;119(8):6418-6428 (PubMed: 29236311) [IF=4.237]

28). Zhao H et al. CCL17-CCR4 axis promotes metastasis via ERK/MMP13 pathway in bladder cancer. J Cell Biochem 2018 Sep 19 (PubMed: 30230587) [IF=4.237]

29). Li C;Bai X;Liu X;Zhang Y;Liu L;Zhang L;Xu F;Yang Y;Liu M; et al. Disruption of Epithelial Barrier of Caco-2 Cell Monolayers by excretory secretory products of Trichinella Spiralis might be Related to serine Protease. Front Microbiol 2021 Mar 17;12:634185. (PubMed: 33815318) [IF=4.235]

30). Li X;Liu R;Cui Y;Liang J;Bi Z;Li S;Miao Y;Zhang L;Li X;Zhou H;Yang C; et al. Protective effect of remdesivir against pulmonary fibrosis in mice. Front Pharmacol 2021 Aug 26;12:692346. (PubMed: 34512328) [IF=4.225]

31). Yang Q;Han Y;Liu P;Huang Y;Li X;Jia L;Zheng Y;Li W; et al. Long Noncoding RNA GAS5 Promotes Osteogenic Differentiation of Human Periodontal Ligament Stem Cells by Regulating GDF5 and p38/JNK Signaling Pathway. Front Pharmacol 2020 May 20;11:701. (PubMed: 32508644) [IF=4.225]

32). Wu J;Gan Y;Luo H;Xu N;Chen L;Li M;Guan F;Su Z;Lin Z;Xie J;Liu Y; et al. β-Patchoulene Ameliorates Water Transport and the Mucus Barrier in 5-Fluorouracil-Induced Intestinal Mucositis Rats via the cAMP/PKA/CREB Signaling Pathway. Front Pharmacol 2021 Aug 25;12:689491. (PubMed: 34512326) [IF=4.225]

33). Yang F et al. Ligustilide, a major bioactive component of Angelica sinensis, promotes bone formation via the GPR30/EGFR pathway. Sci Rep 2019 May 6;9(1):6991 (PubMed: 31061445) [IF=3.998]

34). Tan L et al. Dihydroberberine, a hydrogenated derivative of berberine firstly identified in Phellodendri Chinese Cortex, exerts anti-inflammatory effect via dual modulation of NF-κB and MAPK signaling pathways. Int Immunopharmacol 2019 Aug 8;75:105802 (PubMed: 31401380) [IF=3.943]

35). Dai Y;Liu J;Zhang X;Min X;Wu J;Du S;Li T;Liu L;Ding Z; et al. HSPA12A improves endothelial integrity to attenuate lung injury during endotoxemia through activating ERKs and Akt-dependent signaling. Int Immunopharmacol 2021 Jul 31;99:107987. (PubMed: 34343936) [IF=3.943]

36). Xinqiang Y et al. Protective effect of MOTS-c on acute lung injury induced by lipopolysaccharide in mice. Int Immunopharmacol 2020 Mar;80:106174 (PubMed: 31931370) [IF=3.943]

37). Zhang S;Fu B;Xiong Y;Zhao Q;Xu S;Lin X;Wu H; et al. Tgm2 alleviates LPS-induced apoptosis by inhibiting JNK/BCL-2 signaling pathway through interacting with Aga in macrophages. Int Immunopharmacol 2021 Oct 1;101(Pt A):108178. (PubMed: 34607226) [IF=3.943]

38). Zan Liu et al. Novel circRNA_0071196/miRNA‑19b‑3p/CIT axis is associated with proliferation and migration of bladder cancer. INT J ONCOL 2020 Jul; [IF=3.899]

39). Han Y et al. Mechanosensitive ion channel Piezo1 promotes prostate cancer development through the activation of the Akt/mTOR pathway and acceleration of cell cycle. Int J Oncol 2019 Jul 15 (PubMed: 31322184) [IF=3.899]

40). Song T et al. GPR120 promotes adipogenesis through intracellular calcium and extracellular signal-regulated kinase 1/2 signal pathway. Mol Cell Endocrinol 2016 Oct 15;434:1-13 (PubMed: 27302893) [IF=3.871]

Application: WB Species:Not available; Sample:Not available

41). Wang L;Gu J;Zong M;Zhang Q;Li H;Li D;Mou X;Liu P;Liu Y;Qiu F;Zhao F; et al. Anti-inflammatory action of physalin A by blocking the activation of NF-κB signaling pathway. J Ethnopharmacol 2020 Oct 19;113490. (PubMed: 33091501) [IF=3.690]

42). Wang L;Lu S;Wang L;Xin M;Xu Y;Wang G;Chen D;Chen L;Liu S;Zhao F; et al. Anti-inflammatory effects of three withanolides isolated from Physalis angulata L. in LPS-activated RAW 264.7 cells through blocking NF-κB signaling pathway. J Ethnopharmacol 2021 Aug 10;276:114186. (PubMed: 33957208) [IF=3.690]

43). Yan F;Chen L;Chen W;Zhao L;Lu Q;Liu R; et al. Protective effect of procyanidin A-type dimers against H2O2-induced oxidative stress in prostate DU145 cells through the MAPKs signaling pathway. Life Sci 2021 Feb 1;266:118908. (PubMed: 33333048) [IF=3.647]

44). Li Y;Li J;Yuan Q;Bian X;Long F;Duan R;Gao F;Gao S;Wei S;Wang A;Liu A;Li X;Sun W;Liu Q; et al. Deficiency in WDFY4 reduces the number of CD8+ T cells via reactive oxygen species-induced apoptosis. Mol Immunol 2021 Sep 2;139:131-138. (PubMed: 34482201) [IF=3.641]

45). Chen Z et al. Fumonisin B1 damages the barrier functions of porcine intestinal epithelial cells in vitro. J Biochem Mol Toxicol 2019 Sep 26:e22397 (PubMed: 31557363) [IF=3.606]

46). Yi M et al. Exosomes secreted from osteocalcin-overexpressed endothelial progenitor cells promoted endothelial cell angiogenesis. Am J Physiol Cell Physiol 2019 Aug 14 (PubMed: 31411920) [IF=3.485]

47). Zhang T et al. Interaction with tumor‑associated macrophages promotes PRL‑3‑induced invasion of colorectal cancer cells via MAPK pathway‑induced EMT and NF‑κB signaling‑induced angiogenesis. Oncol Rep 2019 Mar 7 (PubMed: 30864736) [IF=3.417]

48). Zhao Y;Ye X;Chen R;Gao Q;Zhao D;Ling C;Qian Y;Xu C;Tao M;Xie Y; et al. Sirtuin 7 promotes non‑small cell lung cancer progression by facilitating G1/S phase and epithelial‑mesenchymal transition and activating AKT and ERK1/2 signaling. Oncol Rep 2020 Sep;44(3):959-972. (PubMed: 32705247) [IF=3.417]

49). Wang W et al. Umbilical cord‑derived mesenchymal stem cells can inhibit the biological functions of melanoma A375 cells. Oncol Rep 2018 Jul;40(1):511-517 (PubMed: 29767256) [IF=3.417]

50). Luan D et al. MST4 modulates the neuro-inflammatory response by regulating IκBα signaling pathway and affects the early outcome of experimental ischemic stroke in mice. Brain Res Bull 2019 Nov 10 (PubMed: 31722252) [IF=3.370]

51). Lu K;Zhou J;Deng J;Li Y;Wu C;Bao J; et al. Periplaneta americana Oligosaccharides Exert Anti-Inflammatory Activity through Immunoregulation and Modulation of Gut Microbiota in Acute Colitis Mice Model. Molecules 2021 Mar 19;26(6):1718. (PubMed: 33808686) [IF=3.267]

52). Xia C et al. Novel Peptide CM 7 Targeted c-Met with Antitumor Activity. Molecules 2020 Jan 21;25(3) (PubMed: 31973231) [IF=3.267]

53). Yin X et al. The intraperitoneal administration of MOTS-c produces antinociceptive and anti-inflammatory effects through the activation of AMPK pathway in the mouse formalin test. Eur J Pharmacol 2020 Jan 8;870:172909 (PubMed: 31926126) [IF=3.263]

54). Zhang S et al. A novel, highly-water-soluble apigenin derivative provides neuroprotection following ischemia in male rats by regulating the ERK/Nrf2/HO-1 pathway. Eur J Pharmacol 2019 Mar 14 (PubMed: 30880180) [IF=3.263]

55). Liu Y et al. (3R, 7R)-7-Acetoxyl-9-Oxo-de-O-Methyllasiodiplodin, a Secondary Metabolite of Penicillium Sp., Inhibits LPS-Mediated Inflammation in RAW 264.7 Macrophages through Blocking ERK/MAPKs and NF-κB Signaling Pathways. Inflammation 2019 Apr 23 (PubMed: 31011928) [IF=3.212]

56). Jiang M;Lash GE;Zeng S;Liu F;Han M;Long Y;Cai M;Hou H;Ning F;Hu Y;Yang H; et al. Differential expression of serum proteins before 20 weeks gestation in women with hypertensive disorders of pregnancy: A potential role for SH3BGRL3. Placenta 2020 Nov 14;104:20-30. (PubMed: 33217630) [IF=3.177]

57). Wu CX et al. Electroacupuncture exerts neuroprotective effects on ischemia/reperfusion injury in JNK knockout mice: the underlying mechanism. Neural Regen Res 2018 Sep;13(9):1594-1601 (PubMed: 30127120) [IF=3.171]

58). Qian Y;Chen H;Pan T;Li T;Zhang Z;Lv X;Wang J;Ji Z;He Y;Li L;Lin M; et al. Autologous decellularized extracellular matrix promotes adipogenic differentiation of adipose derived stem cells in low serum culture system by regulating the ERK1/2-PPARγ pathway. Adipocyte 2021 Dec;10(1):174-188. (PubMed: 33825675) [IF=3.146]

59). Tang Q et al. Ferroptosis is newly characterized form of neuronal cell death in response to arsenite exposure. Neurotoxicology 2018 Jul;67:27-36 (PubMed: 29678591) [IF=3.105]

60). Shi Q;Lang W;Wang S;Li G;Bai X;Yan X;Zhang H; et al. Echinacea polysaccharide attenuates lipopolysaccharide‑induced acute kidney injury via inhibiting inflammation, oxidative stress and the MAPK signaling pathway. Int J Mol Med 2020 Oct 23;47(1):243-255. (PubMed: 33416087) [IF=3.098]

61). Liao ZL et al. Salidroside protects PC-12 cells against amyloid β-induced apoptosis by activation of the ERK1/2 and AKT signaling pathways. Int J Mol Med 2019 Feb 1 (PubMed: 30720058) [IF=3.098]

62). Huang C et al. Estrogen regulates excitatory amino acid carrier 1 (EAAC1) expression through sphingosine kinase 1 (SphK1) transacting FGFR-mediated ERK signaling in rat C6 astroglial cells. Neuroscience 2016 Apr 5;319:9-22 (PubMed: 26804240) [IF=3.056]

Application: WB Species:rat; Sample:rat

Fig. 4. FGFR- ERK signaling pathway is involved in FGF2-induced EAAC1 expression. (A) C6 cells were incubated with FGF2 (10 ng/mL) for different durations. (B, C) Before incubation with FGF2 (10 ng/mL) for 15 min (B) or 24 h (C), cells were pretreated with the FGFR kinase inhibitor SU5402 (SU; 25 lM, 5 min) or the ERK inhibitor U0126 (U0; 10 lM, 1 h). Phosphorylation of FRS2a or ERK1/2 (A and B, respectively), and EAAC1 expression (C) were analyzed by Western blots. Data are shown as mean ± SEM from three independent experiments. * p < 0.05; **p < 0.01 versus the control group. # p < 0.05; ##p < 0.01 versus the FGF2 alone group.

63). Deng LJ et al. Oxabicycloheptene Sulfonate Protects Against β-Amyloid-induced Toxicity by Activation of PI3K/Akt and ERK Signaling Pathways Via GPER1 in C6 Cells. Neurochem Res 2017 Aug;42(8):2246-2256 (PubMed: 28374135) [IF=3.038]

Application: WB Species:rat; Sample:C6 Cells

Fig. 3 OBHS and RAL increase Akt and ERK phosphorylation through GPER1. a Akt and ERK inhibitors attenuated the pro-survival effects of OBHS and RAL against Aβ toxicity. Cells were pretreated with specific inhibitors LY294002 (LY, 20 μM), U0126 (U,10 μM) for one hour and then incubated with OBHS (1 μM) or RAL (1 μM) for 45 min, after Aβ treatment for an additional 24 h. Cell viability was measured by MTT method. b,c C6 cells were preincubated with PI3K/Akt inhibitor LY (b) or ERK inhibitor U (c) for one hour, followed by OBHS (1 μM) or RAL (1 μM) treatment for 15 min. d GPER1 antagonist G15 (10 μM) was added to the media for 24 h, before OBHS (1 μM) or RAL (1 μM) treatment for 15 min of C6 cells. The proteins were analyzed by the western blot method. The data were shown as the mean±SD from three independent experiments.

64). Cui C et al. Hypoxic postconditioning attenuates apoptosis via inactivation of adenosine A2a receptor through NDRG3-Raf-ERK pathway. Biochem Biophys Res Commun 2017 Sep 16;491(2):277-284 (PubMed: 28743501)

Application: WB Species:human; Sample:Not available

Fig.2 Protein Expression of NDRD3-Raf-ERK pathway, A2a receptors, Cytochrome C.

65). Wu Z et al. MFAP5 promotes tumor progression and bone metastasis by regulating ERK/MMP signaling pathways in breast cancer. Biochem Biophys Res Commun 2018 Apr 6;498(3):495-501 (PubMed: 29526753)

66). Li M;Sun P;Dong K;Xin Y;TaiLulu A;Li Q;Sun J;Peng M;Shi P; et al. Chemerin reverses the malignant phenotype and induces differentiation of human hepatoma SMMC7721 cells. Arch Pharm Res 2021 Jan 27. (PubMed: 33502677)

67). Wang S;Wei H;Huang Z;Wang X;Shen R;Wu Z;Lin J; et al. Epidermal growth factor receptor promotes tumor progression and contributes to gemcitabine resistance in osteosarcoma. Acta Biochim Biophys Sin (Shanghai) 2021 Mar 2;53(3):317-324. (PubMed: 33432347)

68). Su Z et al. HMGB1 modulates Lewis cell autophagy and promotes cell survival via RAGE-HMGB1-Erk1/2 positive feedback during nutrient depletion. Immunobiology 2015 May;220(5):539-44 (PubMed: 25578401)

Application: WB Species:Not available; Sample:Not available

69). Huang YX et al. Ovostatin 2 knockdown significantly inhibits the growth, migration, and tumorigenicity of cutaneous malignant melanoma cells. PLoS One 2018 Apr 23;13(4):e0195610 (PubMed: 29684087)

70). Yuan Q et al. The role of adenosine in up-regulation of p38 MAPK and ERK during limb ischemic preconditioning-induced brain ischemic tolerance. Brain Res 2018 Nov 13 (PubMed: 30445027)

71). Zhang L;Xia H;Xia K;Liu X;Zhang X;Dai J;Zeng Z;Jia Y; et al. Selenium Regulation of the Immune Function of Dendritic Cells in Mice Through the ERK, Akt and RhoA/ROCK Pathways. Biol Trace Elem Res 2020 Oct 26. (PubMed: 33107016)

72). Gao X;Yang Y;Liu X;Wang Y;Yang Y;Boireau P;Liu M;Bai X; et al. Extracellular vesicles derived from Trichinella spiralis prevent colitis by inhibiting M1 macrophage polarization. Acta Trop 2021 Jan;213:105761. (PubMed: 33221281)

73). Xie XC et al. Relaxin Attenuates Contrast-Induced Human Proximal Tubular Epithelial Cell Apoptosis by Activation of the PI3K/Akt Signaling Pathway In Vitro. Biomed Res Int 2017;2017:2869405 (PubMed: 28540295)

74). Liu H;Zhang X;Shao Y;Lin X;Dong F;Liu X; et al. Danshensu alleviates bleomycin-induced pulmonary fibrosis by inhibiting lung fibroblast-to-myofibroblast transition via the MEK/ERK signaling pathway. Bioengineered 2021 Dec;12(1):3113-3124. (PubMed: 34187349)

75). Jin X et al. 11-O-acetylcyathatriol inhibits MAPK/p38-mediated inflammation in LPS-activated RAW 264.7 macrophages and has a protective effect on ethanol-induced gastric injury. Mol Med Rep 2016 Jul;14(1):874-80 (PubMed: 27222252)

Application: WB Species:mouse; Sample:Not available

Figure 3. Effects of 11‑O‑acetylcyathatriol on the protein expression levels of iNOS and COX‑2. The RAW 264.7 cells were treated by 1 µg/ml of LPS with indicated concentrations of 11-O‑acetylcyathatriol (12.5, 25, 50 and 100 µM) for 24 h, and the expression levels of (A) iNOS and COX‑2 were detected using western blot analysis. (B) Effects of 11‑O-acetylcyathatriol on the phosphorylation of ERK1/2, JNK and p38 proteins. RAW 264.7 cells were treated with 1 µg/ml LPS with 11‑O‑acetylcyathatriol (12.5, 25, 50 and 100 µM) for 30 min, and the protein expression levels of p‑ERK1/2, p‑JNK and p‑p38 were detected using western blot analysis. (C) Effects of 11‑O-acetylcyathatriol on the protein degradation of IκB-α. RAW 264.7 cells were treated with 1 µg/ml of LPS with 11-O‑acetylcyathatriol (12.5, 25, 50 and 100 µM) for 10 min, and the protein expression of IκB-α was detected using western blot analysis. iNOS, inducible nitric oxide synthase; COX‑2, cyclooxygenase‑2; LPS, lipopolysaccharide; ERK, extracellular signal‑regulated kinase; JNK, c‑Jun N‑terminal kinase; IκB-α, inhibitor of nuclear factor-κB-α; p‑, phosphorylated.

76). Li H et al. Dysifragilone A inhibits LPS‑induced RAW264.7 macrophage activation by blocking the p38 MAPK signaling pathway. Mol Med Rep 2018 Jan;17(1):674-682 (PubMed: 29115475)

77). Zou C;Yang H;Cui L;Cao X;Huang H;Chen T; et al. Potential hazardous effects of printing room PM2. 5 exposure include promotion of lung inflammation and subsequent injury. Mol Med Rep 2020 Oct;22(4):3213-3224. (PubMed: 32945461)

78). El-Shamarka MEA et al. The protective effect of inosine against rotenone-induced Parkinson's disease in mice; role of oxido-nitrosative stress, ERK phosphorylation, and A2AR expression. Naunyn Schmiedebergs Arch Pharmacol 2020 Jan 8 (PubMed: 31915844)

79). Zhang D;Qi D;Xu Y;Hu C;Zhang X;Yang Q;Shang Z;Zhang G; et al. The S1PR1 Agonist SEW2871 promotes the Survival of Skin Flap. Can J Physiol Pharmacol 2021 Jul 26. (PubMed: 34310896)

80). Xin H et al. Chemokine CXCL3 mediates prostate cancer cells proliferation, migration and gene expression changes in an autocrine/paracrine fashion. Int Urol Nephrol 2018 May;50(5):861-868 (PubMed: 29524043)

81). Zhang X et al. Neuroprotective Effect of Modified Xijiao Dihuang Decoction against Oxygen-Glucose Deprivation and Reoxygenation-Induced Injury in PC12 Cells: Involvement of TLR4-MyD88/NF-κB Signaling Pathway. Evid Based Complement Alternat Med 2017;2017:3848595 (PubMed: 29234386)

82). Wu CZ;Li X;Hong L;Han ZN;Liu Y;Wei CX;Cui X; et al. NOX4/Src regulates ANP secretion through activating ERK1/2 and Akt/GATA4 signaling in beating rat hypoxic atria. Korean J Physiol Pharmacol 2021 Mar 1;25(2):159-166. (PubMed: 33602886)

83). Chai L et al. Biological functions of lung cancer cells are suppressed in co-culture with mesenchymal stem cells isolated from umbilical cord. Exp Ther Med 2018 Jan;15(1):1076-1080 (PubMed: 29399109)

84). Liu YL;Chen BY;Nie J;Zhao GH;Zhuo JY;Yuan J;Li YC;Wang LL;Chen ZW; et al. Polydatin prevents bleomycin‑induced pulmonary fibrosis by inhibiting the TGF‑β/Smad/ERK signaling pathway. Exp Ther Med 2020 Nov;20(5):62. (PubMed: 32952652)

85). Chen Z;Liu L;Liu Y;Wang S;Zhang S;Dong R;Xu M;Ma Y;Wang J;Zhang Q;Wei P; et al. Hydroxysafflor yellow A induces autophagy in human liver cancer cells by regulating Beclin 1 and ERK expression. Exp Ther Med 2020 Apr;19(4):2989-2996. (PubMed: 32256785)

86). Jin X et al. Tiliroside, the major component of Agrimonia pilosa Ledeb ethanol extract, inhibits MAPK/JNK/p38-mediated inflammation in lipopolysaccharide-activated RAW 264.7 macrophages. Exp Ther Med 2016 Jul;12(1):499-505 (PubMed: 27347085)

Application: WB Species:mouse; Sample:Not available

Figure 7. Effect of tiliroside on the phosphorylation of mitogen‑activated protein kinase‑ERK/JNK/p38 proteins. (A) RAW 264.7 cells were treated with LPS 1 µg/ml with or without tiliroside (12.5, 25, 50, and 100 µM) for 45 min and the expression of p‑ERK1/2, p‑JNK and p‑p38 was assessed by western blot analysis. Detection of β‑actin was conducted to confirm the equal loading of proteins. Densitometric analysis of p‑ERK1/2 (B) p‑JNK (C) and p‑p38 (D) expression represent the mean±standard deviation of three separate experiments. Data were normalized with respect to β‑actin levels. **P

87). Zhang Q et al. Anti-inflammatory action of ambuic acid, a natural product isolated from the solid culture of Pestalotiopsis neglecta, through blocking ERK/JNK mitogen-activated protein kinase signaling pathway. Exp Ther Med 2018 Aug;16(2):1538-1546 (PubMed: 30116402)

88). Zhou B;Zhao G;Zhu Y;Chen X;Zhang N;Yang J;Lin H; et al. Protective Effects of Nicotinamide Riboside on H2O2-induced Oxidative Damage in Lens Epithelial Cells. Curr Eye Res 2020 Dec 9;1-10. (PubMed: 33297791)

89). Li M;Xiao YB;Wang XT;Zhuang JP;Zhou CL; et al. Proline-Serine–Threonine Phosphatase-Interacting Protein 2 Alleviates Diabetes Mellitus-Osteoarthritis in Rats through Attenuating Synovial Inflammation and Cartilage Injury. Orthop Surg 2021 May 3. (PubMed: 33939302)

90). Sun J;Zhang Q;Liu X;Shang X; et al. Downregulation of IFIT3 relieves the inflammatory response and myocardial fibrosis of mice with myocardial infarction and improves their cardiac function. Exp Anim 2021 Jul 8. (PubMed: 34234081)

91). Zhang L;Dai J;Zeng Z;Jia Y; et al. Nitric oxide induces HepG2 cell death via extracellular signal-regulated protein kinase activation by regulating acid sphingomyelinase. Mol Biol Rep 2020 Oct;47(10):8353-8359. (PubMed: 33025504)

92). Huikun Xu et al. Chemerin promotes the viability and migration of human placental microvascular endothelial cells and activates MAPK/AKT signaling . Int J Clin Exp Med 2018;11(2):721-727

93). Peng J et al. MiR-377 promotes white adipose tissue inflammation and decreases insulin sensitivity in obesity via suppression of sirtuin-1 (SIRT1). Oncotarget 2017 Jul 31;8(41):70550-70563 (PubMed: 29050301)

Application: WB Species:mouse; Sample:Not available

Figure 4: MiR-377 promotes inﬂammation and insulin-resistance in mature 3T3-L1 cells. After transfection with 100 nM miR-377 mimics or inhibitor for 24 h, differentiated 3T3-L1 adipocytes were treated with 10 ng/ml TNFα for 24 h and then stimulated with 100 nM insulin for 15 min. Cells were then harvested for real-time PCR and immunoblotting analyses. (A) The effect of miR-377 overexpression on inﬂammation-related gene expression. *P < 0.05, **P < 0.01 vs. NC 0.1% BSA; ##P < 0.01 vs. NC 10 ng/ml TNFα; ns, not signifcant (n = 3). (B) The effect of miR-377 inhibition on inﬂammation-related gene expression under conditions of TNFα-induced insulin-resistance. ##P < 0.01 vs. NC 10 ng/ml TNFα(n = 3). (C) The effect of miR-377 overexpression on JNK phosphorylation under conditions of TNFα-induced insulin-resistance. *P < 0.05 vs. NC without insulin; #P < 0.05 vs. NC with insulin (n = 3). (D and E) The effect of miR-377 overexpression on AKT and ERK phosphorylation. *P < 0.05 vs. NC with 0.1% BSA and insulin; #P < 0.05 vs. NC with 10 ng/ml TNFα and insulin (n = 3). (F) The effect of miR-377 inhibition on JNK phosphorylation under conditions of TNFα-induced insulin-resistance. *P < 0.05 vs. NC without insulin; #P < 0.05 vs. NC with insulin (n = 3). (G and H) The effect of miR-377 inhibition on AKT and ERK phosphorylation. *P < 0.05 vs. NC with 0.1% BSA and insulin; #P < 0.05 vs. NC with 10 ng/ml TNFα and insulin (n = 3).

94). Liu X et al. MicroRNA-370 inhibits the growth and metastasis of lung cancer by down-regulating epidermal growth factor receptor expression. Oncotarget 2017 Oct 4;8(50):88139-88151 (PubMed: 29152147)

Application: WB Species:human; Sample:Not available

Figure 4: Induction of miR-370 over-expression reduces EGFR and HIF-1α expression and inhibits the ERK and AKT phosphorylation in XWLC-05 and H157 cells. XWLC-05 and H157 cells were transfected with miR-370 mimics, miR-370 inhibitor or corresponding controls for 24 h. The relative levels of EGFR, HIF-1α, ERK, AKT expression, ERK and AKT phosphorylation were determined by Western blot assays. Data are representative images or expressed as the means ± SEM of each group of cells from three separate experiments. *P<0.05, **P<0.01, ***P<0.001, ****P<0.0001.

95). Li ZH et al. miR-29a regulated ER-positive breast cancer cell growth and invasion and is involved in the insulin signaling pathway. Oncotarget 2017 May 16;8(20):32566-32575 (PubMed: 28427228)

Application: WB Species:human; Sample:MCF-7

Figure 5: Effect of miR-29a on the insulin signaling pathways. (A) IGF-1R, CDC42, p85α, p-ERK and ERK mRNA levels were determined by qPCR in ER-positive cells transfected with a miR-29a mimic or miR-29a inhibitor. (B, C) Western blotting analysis was performed to monitor IGF-1R, CDC42, p85α, p-ERK and ERK expression in ER-positive cells transfected with a miR-29a mimic or miR-29a inhibitor. The results showed that ERK, CDC42 and p85α are the target genes of miR-29a; however, miR-29a promotes breast cancer cell growth and proliferation mainly by activating ERK phosphorylation.

96). Xia H;Zhang L;Dai J;Liu X;Zhang X;Zeng Z;Jia Y; et al. Effect of Selenium and Peroxynitrite on Immune Function of Immature Dendritic Cells in Humans. Med Sci Monit 2021 Mar 8;27:e929004. (PubMed: 33684094)

97). Hu X;Liu X;Bai X;Yang L;Ding J;Jin X;Li C;Zhang Y;Li Y;Yang Y;Liu M; et al. Effects of Trichinella spiralis and its excretory/secretory products on autophagy of host muscle cells in vivo and in vitro. PLoS Negl Trop Dis 2021 Feb 18;15(2):e0009040. (PubMed: 33600403)

98). et al. Olanzapine-Induced Activation of Hypothalamic Astrocytes and Toll-Like Receptor-4 Signaling via Endoplasmic Reticulum Stress Were Related to Olanzapine-Induced Weight Gain.

99). et al. Discovery of Novel Pterostilbene Derivatives That Might Treat Sepsis by Attenuating Oxidative Stress and Inflammation through Modulation of MAPKs/NF-κB Signaling Pathways.

100). et al. C-X3-C motif chemokine ligand 1/receptor 1 regulates the M1 polarization and chemotaxis of macrophages after hypoxia/reoxygenation injury.

101). Xu G;Lei H;Yuan Q;Chen H;Su J; et al. Inhibition of chikusetsusaponin IVa on inflammatory responses in RAW264. 7 cell line via MAPK pathway. Z Naturforsch C J Biosci 2020 Sep 28;76(3-4):103-110. (PubMed: 32986614)

102). Miao Z et al. Transcriptome sequencing reveals fibrotic associated-genes involved in bovine mammary fibroblasts with Staphylococcus aureus. Int J Biochem Cell Biol 2020 Apr;121:105696 (PubMed: 32001362)

103). et al. Hyperforin Ameliorates Imiquimod-Induced Psoriasis-Like Murine Skin Inflammation by Modulating IL-17A–Producing γδ T Cells.

104). et al. Inhibition of SDF-1/CXCR4 Axis to Alleviate Abnormal Bone Formation and Angiogenesis Could Improve the Subchondral Bone Microenvironment in Osteoarthritis.

105). et al. Assessment of the effect of ethanol extracts from Cinnamomum camphora seed kernel on intestinal inflammation using simulated gastrointestinal digestion and a Caco-2/RAW264.7 co-culture system.

106). et al. Inhibition of extracellular signal-regulated kinase/calpain-2 pathway reduces neuroinflammation and necroptosis after cerebral ischemia-reperfusion injury in a rat model of cardiac arrest.

107). et al. Atherosclerosis by Inhibition of Inflammatory Pathways.

108). Zheng X;Zhang L;Jiang W;Abasubong KP;Zhang C;Zhang D;Li X;Jiang G;Chi C;Liu W; et al. Effects of dietary icariin supplementation on the ovary development-related transcriptome of Chinese mitten crab (Eriocheir sinensis). Comp Biochem Physiol Part D Genomics Proteomics 2020 Nov 11;37:100756. (PubMed: 33197858)

109). et al. Effect of Supplementation Yeast Fermentation Products on Growth Performance and Intestinal Health of Weaned Piglets Challenged With Salmonella Typhimurium.

暂时还没有任何用户评论

评论提交

Catalog Number :

AF1015-BP
(Blocking peptide available as AF1015-BP)

Price/Size :

￥2000/1mg.
Tips: For phospho antibody, we provide phospho peptide（0.5mg) and non-phospho peptide(0.5mg).

Function :

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. This mechanism is useful when non-specific binding is an issue, for example, in Western blotting (immunoblot) and immunohistochemistry (IHC). By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific; Specific binding will be absent from the western blot or immunostaining performed with the neutralized antibody.

Format and storage :

Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 10 mg/ml.The purity is >90%,tested by HPLC and MS.Storage Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.

Precautions :

This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Pig

100%

Horse

100%

Bovine

100%

Sheep

100%

Zebrafish

100%

Rabbit

100%

Dog

Xenopus

Chicken

High similarity Medium similarity Low similarity No similarity

P27361/P28482 as Substrate

P27361
P28482

Site	PTM Type	Enzyme	Source
A2	Acetylation		Uniprot
K32	Ubiquitination		Uniprot
S58	Phosphorylation		Uniprot
K72	Ubiquitination		Uniprot
T80	Phosphorylation		Uniprot
Y130	Phosphorylation		Uniprot
K155	Ubiquitination		Uniprot
S159	Phosphorylation		Uniprot
S170	Phosphorylation		Uniprot
K181	Acetylation		Uniprot
K181	Ubiquitination		Uniprot
T198	Phosphorylation		Uniprot
T202	Phosphorylation	Q02750 (MAP2K1) , P36507 (MAP2K2)	Uniprot
Y204	Phosphorylation	P27361 (MAPK3) , O60674 (JAK2) , Q02750 (MAP2K1) , P07949 (RET) , P06239 (LCK) , P36507 (MAP2K2)	Uniprot
T207	Phosphorylation	Q02750 (MAP2K1) , P27361 (MAPK3)	Uniprot
Y210	Phosphorylation	Q02750 (MAP2K1)	Uniprot
R211	Methylation		Uniprot
S219	Phosphorylation		Uniprot
K220	Ubiquitination		Uniprot
Y222	Phosphorylation		Uniprot
T223	Phosphorylation		Uniprot
S265	Phosphorylation		Uniprot
K287	Ubiquitination		Uniprot
K289	Ubiquitination		Uniprot
K294	Ubiquitination		Uniprot
K298	Ubiquitination		Uniprot
K302	Methylation		Uniprot
K302	Ubiquitination		Uniprot
R309	Methylation		Uniprot
K317	Ubiquitination		Uniprot
K357	Ubiquitination		Uniprot
K361	Methylation		Uniprot
K361	Ubiquitination		Uniprot

Site	PTM Type	Enzyme	Source
A2	Acetylation		Uniprot
Y25	Phosphorylation		Uniprot
S29	Phosphorylation	O00141 (SGK1)	Uniprot
Y36	Phosphorylation		Uniprot
Y43	Phosphorylation		Uniprot
K55	Ubiquitination		Uniprot
T63	Phosphorylation		Uniprot
C65	S-Nitrosylation		Uniprot
K99	Ubiquitination		Uniprot
Y113	Phosphorylation		Uniprot
K138	Ubiquitination		Uniprot
S142	Phosphorylation		Uniprot
K151	Ubiquitination		Uniprot
K164	Ubiquitination		Uniprot
C166	S-Nitrosylation		Uniprot
T181	Phosphorylation		Uniprot
T185	Phosphorylation	Q02750 (MAP2K1) , P36507 (MAP2K2)	Uniprot
Y187	Phosphorylation	P28482 (MAPK1) , P07949 (RET) , O60674 (JAK2) , Q02750 (MAP2K1) , P36507 (MAP2K2)	Uniprot
T190	Phosphorylation	P28482 (MAPK1)	Uniprot
Y193	Phosphorylation		Uniprot
R194	Methylation		Uniprot
S202	Phosphorylation		Uniprot
K203	Ubiquitination		Uniprot
Y205	Phosphorylation		Uniprot
T206	Phosphorylation		Uniprot
S246	Phosphorylation	P68400 (CSNK2A1) , P28482 (MAPK1)	Uniprot
S248	Phosphorylation	P68400 (CSNK2A1)	Uniprot
K259	Ubiquitination		Uniprot
Y263	Phosphorylation		Uniprot
K270	Ubiquitination		Uniprot
K272	Ubiquitination		Uniprot
S284	Phosphorylation		Uniprot
K285	Ubiquitination		Uniprot
K292	Ubiquitination		Uniprot
T295	Phosphorylation		Uniprot
K300	Ubiquitination		Uniprot
K330	Ubiquitination		Uniprot
K340	Ubiquitination		Uniprot
K344	Ubiquitination		Uniprot
S360	Phosphorylation		Uniprot

P27361/P28482 as PTM Enzyme

P27361
P28482

Substrate	Site	Source
C9JLW8 (MCRIP1)	S21	Uniprot
C9JLW8 (MCRIP1)	T30	Uniprot
O00213 (APBB1)	S175	Uniprot
O00213 (APBB1)	S287	Uniprot
O00213 (APBB1)	S347	Uniprot
O00213 (APBB1)	T709	Uniprot
O00429 (DNM1L)	S616	Uniprot
O14994 (SYN3)	S470	Uniprot
O43521 (BCL2L11)	S69	Uniprot
O43524 (FOXO3)	S294	Uniprot
O43524 (FOXO3)	S344	Uniprot
O43524 (FOXO3)	S425	Uniprot
O43561-2 (LAT)	T155	Uniprot
O43561 (LAT)	T184	Uniprot
O60244 (MED14)	S986	Uniprot
O60331 (PIP5K1C)	S650	Uniprot
O60674 (JAK2)	S523	Uniprot
O75030-9 (MITF)	S73	Uniprot
O75581 (LRP6)	S1490	Uniprot
O75581 (LRP6)	T1572	Uniprot
O75582 (RPS6KA5)	S360	Uniprot
O75582-2 (RPS6KA5)	S376	Uniprot
O75582-1 (RPS6KA5)	T581	Uniprot
O75582 (RPS6KA5)	T700	Uniprot
O95644 (NFATC1)	S172	Uniprot
O95997 (PTTG1)	S165	Uniprot
P00533 (EGFR)	T693	Uniprot
P01100 (FOS)	T232	Uniprot
P01100 (FOS)	T325	Uniprot
P01100 (FOS)	T331	Uniprot
P01100 (FOS)	S374	Uniprot
P02686 (MBP)	S96	Uniprot
P02686 (MBP)	T232	Uniprot
P03372 (ESR1)	S104	Uniprot
P03372 (ESR1)	S106	Uniprot
P03372 (ESR1)	S118	Uniprot
P04049 (RAF1)	S289	Uniprot
P04049 (RAF1)	S296	Uniprot
P04049 (RAF1)	S301	Uniprot
P04150 (NR3C1)	S226	Uniprot
P04637 (TP53)	S15	Uniprot
P04637 (TP53)	S392	Uniprot
P05412 (JUN)	S63	Uniprot
P05412 (JUN)	S73	Uniprot
P05787-1 (KRT8)	S74	Uniprot
P05787 (KRT8)	S432	Uniprot
P06239 (LCK)	S42	Uniprot
P06239 (LCK)	S59	Uniprot
P06401 (PGR)	S294	Uniprot
P07101-3 (TH)	S31	Uniprot
P07101-4 (TH)	S35	Uniprot
P07101-2 (TH)	S58	Uniprot
P07101 (TH)	S62	Uniprot
P08047 (SP1)	S59	Uniprot
P08047 (SP1)	T453	Uniprot
P08047 (SP1)	T739	Uniprot
P09917 (ALOX5)	S664	Uniprot
P10242 (MYB)	S532	Uniprot
P10275 (AR)	S516	Uniprot
P10275 (AR)	S651	Uniprot
P10415 (BCL2)	T56	Uniprot
P10415 (BCL2)	S70	Uniprot
P10415 (BCL2)	T74	Uniprot
P10415 (BCL2)	S87	Uniprot
P10636-8 (MAPT)	S46	Uniprot
P10636-8 (MAPT)	T50	Uniprot
P10636-8 (MAPT)	T153	Uniprot
P10636-8 (MAPT)	T175	Uniprot
P10636-8 (MAPT)	T181	Uniprot
P10636-8 (MAPT)	S199	Uniprot
P10636-8 (MAPT)	S202	Uniprot
P10636-8 (MAPT)	T205	Uniprot
P10636-8 (MAPT)	T212	Uniprot
P10636-8 (MAPT)	T217	Uniprot
P10636-8 (MAPT)	T231	Uniprot
P10636-8 (MAPT)	S235	Uniprot
P10636-8 (MAPT)	S396	Uniprot
P10636-8 (MAPT)	S404	Uniprot
P10636-8 (MAPT)	S422	Uniprot
P10828 (THRB)	S142	Uniprot
P11362 (FGFR1)	S777	Uniprot
P11388 (TOP2A)	S1213	Uniprot
P11388 (TOP2A)	S1247	Uniprot
P11388 (TOP2A)	S1354	Uniprot
P11388 (TOP2A)	S1361	Uniprot
P11388 (TOP2A)	S1393	Uniprot
P12980 (LYL1)	S36	Uniprot
P13631 (RARG)	S77	Uniprot
P13631 (RARG)	S79	Uniprot
P14598 (NCF1)	S345	Uniprot
P14598 (NCF1)	S348	Uniprot
P14784 (IL2RB)	T476	Uniprot
P14921 (ETS1)	T38	Uniprot
P15036 (ETS2)	T72	Uniprot
P15056 (BRAF)	S151	Uniprot
P15056 (BRAF)	T401	Uniprot
P15056 (BRAF)	T753	Uniprot
P15336 (ATF2)	T69	Uniprot
P15336 (ATF2)	T71	Uniprot
P15923-1 (TCF3)	T355	Uniprot
P15976 (GATA1)	S26	Uniprot
P16144 (ITGB4)	S1356	Uniprot
P16220 (CREB1)	S133	Uniprot
P16949 (STMN1)	S25	Uniprot
P16949 (STMN1)	S38	Uniprot
P17302 (GJA1)	S255	Uniprot
P17302 (GJA1)	S279	Uniprot
P17302 (GJA1)	S282	Uniprot
P17480 (UBTF)	T117	Uniprot
P17480 (UBTF)	T201	Uniprot
P17535 (JUND)	S100	Uniprot
P17542-1 (TAL1)	S122	Uniprot
P17600 (SYN1)	S62	Uniprot
P17600 (SYN1)	S67	Uniprot
P17600 (SYN1)	S551	Uniprot
P17655 (CAPN2)	S50	Uniprot
P17676 (CEBPB)	T235	Uniprot
P17861 (XBP1)	S68	Uniprot
P17861 (XBP1)	S181	Uniprot
P18545 (PDE6G)	T22	Uniprot
P19419 (ELK1)	S324	Uniprot
P19419 (ELK1)	T336	Uniprot
P19419 (ELK1)	S383	Uniprot
P19419 (ELK1)	S389	Uniprot
P19419 (ELK1)	S422	Uniprot
P19793 (RXRA)	S260	Uniprot
P20339 (RAB5A)	S123	Uniprot
P23396 (RPS3)	T42	Uniprot
P23443 (RPS6KB1)	S434	Uniprot
P24928 (POLR2A)	S1619	Uniprot
P24928 (POLR2A)	S1626	Uniprot
P24928 (POLR2A)	S1647	Uniprot
P24928 (POLR2A)	S1654	Uniprot
P24928 (POLR2A)	S1668	Uniprot
P24928 (POLR2A)	S1675	Uniprot
P24928 (POLR2A)	S1696	Uniprot
P24928 (POLR2A)	S1717	Uniprot
P24928 (POLR2A)	S1724	Uniprot
P24928 (POLR2A)	S1738	Uniprot
P24928 (POLR2A)	S1766	Uniprot
P24928 (POLR2A)	S1787	Uniprot
P24928 (POLR2A)	S1864	Uniprot
P24928 (POLR2A)	S1871	Uniprot
P24928 (POLR2A)	S1878	Uniprot
P24928 (POLR2A)	S1892	Uniprot
P24928 (POLR2A)	S1899	Uniprot
P24928 (POLR2A)	S1913	Uniprot
P24928 (POLR2A)	S1920	Uniprot
P24928 (POLR2A)	S1927	Uniprot
P24928 (POLR2A)	S1934	Uniprot
P24928 (POLR2A)	S1944	Uniprot
P24928 (POLR2A)	S1951	Uniprot
P24941 (CDK2)	T160	Uniprot
P25098 (GRK2)	S670	Uniprot
P27361-3 (MAPK3)	T202	Uniprot
P27361 (MAPK3)	Y204	Uniprot
P27361 (MAPK3)	T207	Uniprot
P27708 (CAD)	T456	Uniprot
P27824 (CANX)	S583	Uniprot
P28324 (ELK4)	T361	Uniprot
P28324 (ELK4)	T366	Uniprot
P28324 (ELK4)	S381	Uniprot
P28324 (ELK4)	S387	Uniprot
P28324 (ELK4)	T420	Uniprot
P28324 (ELK4)	S425	Uniprot
P28562 (DUSP1)	S296	Uniprot
P28562 (DUSP1)	S323	Uniprot
P28562 (DUSP1)	S359	Uniprot
P28562 (DUSP1)	S364	Uniprot
P28698 (MZF1)	S256	Uniprot
P28698 (MZF1)	S274	Uniprot
P28698 (MZF1)	S294	Uniprot
P29353 (SHC1)	S36	Uniprot
P29590-4 (PML)	T28	Uniprot
P29590-4 (PML)	S36	Uniprot
P29590-4 (PML)	S38	Uniprot
P29590-4 (PML)	S40	Uniprot
P29590-4 (PML)	S527	Uniprot
P29590-4 (PML)	S530	Uniprot
P30307 (CDC25C)	S216	Uniprot
P31645 (SLC6A4)	T616	Uniprot
P32121 (ARRB2)	S14	Uniprot
P32121 (ARRB2)	T276	Uniprot
P33076 (CIITA)	S280	Uniprot
P33076 (CIITA)	S288	Uniprot
P33981 (TTK)	S821	Uniprot
P35228 (NOS2)	S745	Uniprot
P35236-2 (PTPN7)	T105	Uniprot
P35236-2 (PTPN7)	S132	Uniprot
P35568 (IRS1)	S616	Uniprot
P35658 (NUP214)	S1710	Uniprot
P35658 (NUP214)	S1809	Uniprot
P36956 (SREBF1)	S117	Uniprot
P36956-4 (SREBF1)	S147	Uniprot
P37231 (PPARG)	S112	Uniprot
P40763 (STAT3)	Y705	Uniprot
P40763-2 (STAT3)	S726	Uniprot
P40763 (STAT3)	S727	Uniprot
P41182 (BCL6)	S333	Uniprot
P41182 (BCL6)	S343	Uniprot
P41212 (ETV6)	S213	Uniprot
P41212 (ETV6)	S257	Uniprot
P42224 (STAT1)	S727	Uniprot
P42229 (STAT5A)	S780	Uniprot
P42702 (LIFR)	S1044	Uniprot
P43364 (MAGEA11)	S174	Uniprot
P43694 (GATA4)	S105	Uniprot
P46527 (CDKN1B)	T187	Uniprot
P47712 (PLA2G4A)	S505	Uniprot
P49023-2 (PXN)	S83	Uniprot
P49023-2 (PXN)	S126	Uniprot
P49023 (PXN)	S130	Uniprot
P49137 (MAPKAPK2)	T222	Uniprot
P49137 (MAPKAPK2)	T334	Uniprot
P49407-2 (ARRB1)	S404	Uniprot
P49407-1 (ARRB1)	S412	Uniprot
P49418 (AMPH)	S293	Uniprot
P49418 (AMPH)	S295	Uniprot
P49585 (PCYT1A)	S315	Uniprot
P49675 (STAR)	S233	Uniprot
P49715 (CEBPA)	S21	Uniprot
P49790 (NUP153)	S257	Uniprot
P49790 (NUP153)	S320	Uniprot
P49790 (NUP153)	S334	Uniprot
P49790 (NUP153)	S338	Uniprot
P49790 (NUP153)	T369	Uniprot
P49790 (NUP153)	T388	Uniprot
P49790 (NUP153)	T413	Uniprot
P49790 (NUP153)	S516	Uniprot
P49790 (NUP153)	S522	Uniprot
P49790 (NUP153)	S529	Uniprot
P49815 (TSC2)	S664	Uniprot
P49841 (GSK3B)	T43	Uniprot
P50616 (TOB1)	S152	Uniprot
P50616 (TOB1)	S154	Uniprot
P50616 (TOB1)	S164	Uniprot
P51168 (SCNN1B)	T615	Uniprot
P51170 (SCNN1G)	T622	Uniprot
P51812 (RPS6KA3)	S227	Uniprot
P51812 (RPS6KA3)	T577	Uniprot
P53004 (BLVRA)	S230	Uniprot
P53355 (DAPK1)	S734	Uniprot
P53805-4 (RCAN1)	S32	Uniprot
P53805-2 (RCAN1)	S112	Uniprot
P53805 (RCAN1)	S167	Uniprot
P55211 (CASP9)	T125	Uniprot
P56270 (MAZ)	T72	Uniprot
P61586 (RHOA)	S88	Uniprot
P61586 (RHOA)	T100	Uniprot
P61978 (HNRNPK)	S284	Uniprot
P61978 (HNRNPK)	S353	Uniprot
P63000 (RAC1)	T108	Uniprot
P68431 (HIST1H3J)	S29	Uniprot
P78347-2 (GTF2I)	S627	Uniprot
P78347-2 (GTF2I)	S633	Uniprot
P78347 (GTF2I)	S668	Uniprot
P78347 (GTF2I)	S674	Uniprot
P78536 (ADAM17)	T735	Uniprot
P84022 (SMAD3)	S204	Uniprot
P84243 (H3F3B)	S29	Uniprot
Q00613-1 (HSF1)	S307	Uniprot
Q00975 (CACNA1B)	S411	Uniprot
Q00975 (CACNA1B)	S446	Uniprot
Q01196-8 (RUNX1)	S276	Uniprot
Q01196-8 (RUNX1)	S293	Uniprot
Q01196-8 (RUNX1)	T300	Uniprot
Q01196-8 (RUNX1)	S303	Uniprot
Q01196-8 (RUNX1)	S462	Uniprot
Q01844 (EWSR1)	T79	Uniprot
Q01860 (POU5F1)	S111	Uniprot
Q01892 (SPIB)	T56	Uniprot
Q02447 (SP3)	S73	Uniprot
Q02641 (CACNB1)	S161	Uniprot
Q02641 (CACNB1)	S348	Uniprot
Q02750 (MAP2K1)	T286	Uniprot
Q02750 (MAP2K1)	T292	Uniprot
Q02750 (MAP2K1)	T386	Uniprot
Q04637-8 (EIF4G1)	S1232	Uniprot
Q05209 (PTPN12)	S571	Uniprot
Q05397 (PTK2)	S910	Uniprot
Q05469-1 (LIPE)	T891	Uniprot
Q05682-4 (CALD1)	S534	Uniprot
Q05682 (CALD1)	S759	Uniprot
Q05682 (CALD1)	S789	Uniprot
Q07812 (BAX)	T167	Uniprot
Q07820 (MCL1)	T92	Uniprot
Q07820 (MCL1)	T163	Uniprot
Q07866 (KLC1)	S460	Uniprot
Q07869-1 (PPARA)	S12	Uniprot
Q07869-1 (PPARA)	S21	Uniprot
Q07889 (SOS1)	S1132	Uniprot
Q07889 (SOS1)	S1167	Uniprot
Q07889 (SOS1)	S1178	Uniprot
Q07889 (SOS1)	S1193	Uniprot
Q08499-2 (PDE4D)	S579	Uniprot
Q08499 (PDE4D)	S715	Uniprot
Q09472 (EP300)	S1038	Uniprot
Q09472 (EP300)	S2039	Uniprot
Q12772 (SREBF2)	S432	Uniprot
Q12772 (SREBF2)	S455	Uniprot
Q12800 (TFCP2)	S291	Uniprot
Q12800 (TFCP2)	S309	Uniprot
Q12929 (EPS8)	S625	Uniprot
Q12929 (EPS8)	T629	Uniprot
Q13153 (PAK1)	T292	Uniprot
Q13164 (MAPK7)	T733	Uniprot
Q13322 (GRB10)	S150	Uniprot
Q13322 (GRB10)	S476	Uniprot
Q13362 (PPP2R5C)	S337	Uniprot
Q13480-2 (GAB1)	T312	Uniprot
Q13480-2 (GAB1)	S381	Uniprot
Q13480-2 (GAB1)	S454	Uniprot
Q13480-1 (GAB1)	T476	Uniprot
Q13480-1 (GAB1)	S551	Uniprot
Q13480-1 (GAB1)	S567	Uniprot
Q13480-2 (GAB1)	S581	Uniprot
Q13480-2 (GAB1)	S597	Uniprot
Q13485 (SMAD4)	T277	Uniprot
Q13522 (PPP1R1A)	S67	Uniprot
Q13541 (EIF4EBP1)	S65	Uniprot
Q13586 (STIM1)	S575	Uniprot
Q13586 (STIM1)	S608	Uniprot
Q13586 (STIM1)	S621	Uniprot
Q13614 (MTMR2)	S58	Uniprot
Q13950 (RUNX2)	S24	Uniprot
Q13950 (RUNX2)	S28	Uniprot
Q13950 (RUNX2)	S43	Uniprot
Q13950 (RUNX2)	S275	Uniprot
Q13950 (RUNX2)	S294	Uniprot
Q13950 (RUNX2)	S312	Uniprot
Q13950 (RUNX2)	S314	Uniprot
Q13950 (RUNX2)	S340	Uniprot
Q13950 (RUNX2)	S503	Uniprot
Q14005 (IL16)	S845	Uniprot
Q14160 (SCRIB)	T553	Uniprot
Q14160 (SCRIB)	S1448	Uniprot
Q14247 (CTTN)	S405	Uniprot
Q14247 (CTTN)	S418	Uniprot
Q14790 (CASP8)	S387	Uniprot
Q14934 (NFATC4)	S676	Uniprot
Q15046 (KARS)	S207	Uniprot
Q15366 (PCBP2)	S173	Uniprot
Q15366 (PCBP2)	S189	Uniprot
Q15366 (PCBP2)	T213	Uniprot
Q15366 (PCBP2)	S272	Uniprot
Q15596 (NCOA2)	S736	Uniprot
Q15648 (MED1)	T1032	Uniprot
Q15648 (MED1)	T1457	Uniprot
Q15672 (TWIST1)	S68	Uniprot
Q15746 (MYLK)	S1779	Uniprot
Q15788 (NCOA1)	T1179	Uniprot
Q15788 (NCOA1)	S1185	Uniprot
Q15796 (SMAD2)	T8	Uniprot
Q15796 (SMAD2)	T220	Uniprot
Q15796 (SMAD2)	S245	Uniprot
Q15796 (SMAD2)	S250	Uniprot
Q15796 (SMAD2)	S255	Uniprot
Q15831 (STK11)	S428	Uniprot
Q16204 (CCDC6)	S244	Uniprot
Q16254 (E2F4)	S244	Uniprot
Q16254 (E2F4)	S384	Uniprot
Q16559 (TAL2)	S100	Uniprot
Q16665 (HIF1A)	S641	Uniprot
Q16665 (HIF1A)	S643	Uniprot
Q16690 (DUSP5)	T321	Uniprot
Q16690 (DUSP5)	S346	Uniprot
Q16690 (DUSP5)	S376	Uniprot
Q16828 (DUSP6)	S159	Uniprot
Q16828 (DUSP6)	S174	Uniprot
Q16828 (DUSP6)	S197	Uniprot
Q16828 (DUSP6)	S300	Uniprot
Q2M1Z3 (ARHGAP31)	T789	Uniprot
Q86UC2 (RSPH3)	T286	Uniprot
Q86UR1 (NOXA1)	S282	Uniprot
Q86WB0 (ZC3HC1)	S354	Uniprot
Q86WB0 (ZC3HC1)	S359	Uniprot
Q8IX03 (WWC1)	S542	Uniprot
Q8IX03 (WWC1)	S548	Uniprot
Q8IZP0 (ABI1)	S183	Uniprot
Q8IZP0 (ABI1)	S216	Uniprot
Q8IZP0 (ABI1)	S225	Uniprot
Q8IZP0 (ABI1)	T265	Uniprot
Q8IZP0 (ABI1)	S267	Uniprot
Q8IZP0 (ABI1)	S392	Uniprot
Q8IZP0 (ABI1)	T394	Uniprot
Q8IZP0 (ABI1)	S410	Uniprot
Q8N122 (RPTOR)	S8	Uniprot
Q8N122 (RPTOR)	S696	Uniprot
Q8N122 (RPTOR)	S863	Uniprot
Q8N9N5 (BANP)	T337	Uniprot
Q8N9N5 (BANP)	T352	Uniprot
Q8WX93 (PALLD)	S688	Uniprot
Q8WX93 (PALLD)	S808	Uniprot
Q92793 (CREBBP)	S93	Uniprot
Q92908 (GATA6)	S266	Uniprot
Q92934 (BAD)	S75	Uniprot
Q92974-2 (ARHGEF2)	T678	Uniprot
Q92974 (ARHGEF2)	T679	Uniprot
Q92974-2 (ARHGEF2)	S959	Uniprot
Q93045-1 (STMN2)	S62	Uniprot
Q93045-1 (STMN2)	S73	Uniprot
Q969H0 (FBXW7)	T205	Uniprot
Q969V6 (MRTFA)	S454	Uniprot
Q96FF9 (CDCA5)	S79	Uniprot
Q96FF9 (CDCA5)	S209	Uniprot
Q96Q27 (ASB2)	S323	Uniprot
Q96RK0 (CIC)	S1389	Uniprot
Q96RK0 (CIC)	S1409	Uniprot
Q9BR01 (SULT4A1)	T11	Uniprot
Q9BUB5 (MKNK1)	T385	Uniprot
Q9BZI1 (IRX2)	S317	Uniprot
Q9H8Y8 (GORASP2)	T222	Uniprot
Q9H8Y8 (GORASP2)	T225	Uniprot
Q9NQ66 (PLCB1)	S982	Uniprot
Q9NRA0 (SPHK2)	S387	Uniprot
Q9NRA0 (SPHK2)	T614	Uniprot
Q9NRF2 (SH2B1)	S96	Uniprot
Q9NYA1 (SPHK1)	S225	Uniprot
Q9NYV6 (RRN3)	S633	Uniprot
Q9NYV6 (RRN3)	S649	Uniprot
Q9UBN7 (HDAC6)	T1031	Uniprot
Q9UBN7 (HDAC6)	S1035	Uniprot
Q9UHB6 (LIMA1)	S362	Uniprot
Q9UHB6 (LIMA1)	S604	Uniprot
Q9UIG0 (BAZ1B)	S158	Uniprot
Q9UJY1 (HSPB8)	S24	Uniprot
Q9UJY1 (HSPB8)	S27	Uniprot
Q9UJY1 (HSPB8)	T87	Uniprot
Q9UJY1 (HSPB8)	S159	Uniprot
Q9UKX7 (NUP50)	S221	Uniprot
Q9UKX7 (NUP50)	S315	Uniprot
Q9ULC4 (MCTS1)	T81	Uniprot
Q9UPT5 (EXOC7)	S250	Uniprot
Q9UQC2 (GAB2)	S623	Uniprot
Q9Y6W5 (WASF2)	S343	Uniprot
Q9Y6W5 (WASF2)	T346	Uniprot
Q9Y6W5 (WASF2)	S351	Uniprot

Substrate	Site	Source
C9JLW8 (MCRIP1)	S21	Uniprot
C9JLW8 (MCRIP1)	T30	Uniprot
O00213 (APBB1)	S175	Uniprot
O00213 (APBB1)	S287	Uniprot
O00213 (APBB1)	S347	Uniprot
O00213 (APBB1)	T709	Uniprot
O00267 (SUPT5H)	S666	Uniprot
O00429 (DNM1L)	S616	Uniprot
O00562 (PITPNM1)	T794	Uniprot
O00562 (PITPNM1)	T1223	Uniprot
O14613 (CDC42EP2)	S101	Uniprot
O43251 (RBFOX2)	T7	Uniprot
O43294 (TGFB1I1)	S141	Uniprot
O43521 (BCL2L11)	S69	Uniprot
O43524 (FOXO3)	S294	Uniprot
O43524 (FOXO3)	S344	Uniprot
O43524 (FOXO3)	S425	Uniprot
O43623 (SNAI2)	S87	Uniprot
O43623 (SNAI2)	S104	Uniprot
O60331 (PIP5K1C)	S650	Uniprot
O60502 (OGA)	T709	Uniprot
O60504-2 (SORBS3)	S188	Uniprot
O60504 (SORBS3)	S530	Uniprot
O60504 (SORBS3)	T585	Uniprot
O60749 (SNX2)	T104	Uniprot
O75030-9 (MITF)	S73	Uniprot
O75030 (MITF)	S180	Uniprot
O75151 (PHF2)	S655	Uniprot
O75581 (LRP6)	S1490	Uniprot
O75581 (LRP6)	T1572	Uniprot
O75582 (RPS6KA5)	S360	Uniprot
O75582-1 (RPS6KA5)	S376	Uniprot
O75582 (RPS6KA5)	T581	Uniprot
O75582 (RPS6KA5)	T700	Uniprot
O94804 (STK10)	T952	Uniprot
O94811 (TPPP)	T14	Uniprot
O94811 (TPPP)	S18	Uniprot
O94811 (TPPP)	S160	Uniprot
O95785 (WIZ)	S983	Uniprot
O95863 (SNAI1)	S82	Uniprot
O95863 (SNAI1)	S104	Uniprot
O95997 (PTTG1)	S165	Uniprot
P00533 (EGFR)	T693	Uniprot
P01100 (FOS)	T232	Uniprot
P01100 (FOS)	T325	Uniprot
P01100-1 (FOS)	T331	Uniprot
P01100 (FOS)	S374	Uniprot
P01106 (MYC)	T58	Uniprot
P01106 (MYC)	S62	Uniprot
P01106 (MYC)	S71	Uniprot
P02545 (LMNA)	S22	Uniprot
P02686-5 (MBP)	T99	Uniprot
P02686-1 (MBP)	T229	Uniprot
P02686 (MBP)	T232	Uniprot
P03372 (ESR1)	S104	Uniprot
P03372 (ESR1)	S106	Uniprot
P03372 (ESR1)	S118	Uniprot
P04049-1 (RAF1)	S29	Uniprot
P04049-1 (RAF1)	S289	Uniprot
P04049 (RAF1)	S296	Uniprot
P04049-1 (RAF1)	S301	Uniprot
P04049 (RAF1)	S642	Uniprot
P04150-2 (NR3C1)	S226	Uniprot
P04637-1 (TP53)	S15	Uniprot
P04637 (TP53)	T55	Uniprot
P05023 (ATP1A1)	S16	Uniprot
P05198 (EIF2S1)	S52	Uniprot
P05787-1 (KRT8)	S74	Uniprot
P05787 (KRT8)	T431	Uniprot
P06239 (LCK)	S42	Uniprot
P06239 (LCK)	S59	Uniprot
P06401 (PGR)	S294	Uniprot
P07101-3 (TH)	S31	Uniprot
P07101-2 (TH)	S58	Uniprot
P07101 (TH)	S62	Uniprot
P07196 (NEFL)	T21	Uniprot
P08047 (SP1)	S59	Uniprot
P08047-1 (SP1)	T453	Uniprot
P08047 (SP1)	T739	Uniprot
P09874 (PARP1)	S372	Uniprot
P09874 (PARP1)	T373	Uniprot
P09917 (ALOX5)	S664	Uniprot
P10070 (GLI2)	T903	Uniprot
P10242-1 (MYB)	S532	Uniprot
P10275-1 (AR)	S516	Uniprot
P10415 (BCL2)	T56	Uniprot
P10415 (BCL2)	S70	Uniprot
P10415 (BCL2)	T74	Uniprot
P10415-1 (BCL2)	S87	Uniprot
P10636-8 (MAPT)	S46	Uniprot
P10636-8 (MAPT)	T50	Uniprot
P10636-6 (MAPT)	T117	Uniprot
P10636-2 (MAPT)	T123	Uniprot
P10636-2 (MAPT)	S144	Uniprot
P10636-8 (MAPT)	T153	Uniprot
P10636-8 (MAPT)	T175	Uniprot
P10636-8 (MAPT)	T181	Uniprot
P10636-8 (MAPT)	S199	Uniprot
P10636-8 (MAPT)	S202	Uniprot
P10636-8 (MAPT)	T205	Uniprot
P10636-8 (MAPT)	T212	Uniprot
P10636-8 (MAPT)	T217	Uniprot
P10636-8 (MAPT)	T231	Uniprot
P10636-8 (MAPT)	S235	Uniprot
P10636-8 (MAPT)	S396	Uniprot
P10636-8 (MAPT)	S404	Uniprot
P10636-8 (MAPT)	S422	Uniprot
P10636 (MAPT)	S519	Uniprot
P10636 (MAPT)	T522	Uniprot
P10636 (MAPT)	S721	Uniprot
P10646 (TFPI)	S202	Uniprot
P10828 (THRB)	S142	Uniprot
P11308 (ERG)	S222	Uniprot
P11308 (ERG)	S283	Uniprot
P11362 (FGFR1)	S777	Uniprot
P11388 (TOP2A)	S1213	Uniprot
P11388 (TOP2A)	S1247	Uniprot
P11388 (TOP2A)	S1354	Uniprot
P11388 (TOP2A)	S1361	Uniprot
P11388 (TOP2A)	S1393	Uniprot
P12036 (NEFH)	S518	Uniprot
P12036 (NEFH)	S526	Uniprot
P12036 (NEFH)	S532	Uniprot
P12270 (TPR)	T2116	Uniprot
P12270 (TPR)	T2137	Uniprot
P12270 (TPR)	S2155	Uniprot
P12270 (TPR)	T2214	Uniprot
P12980 (LYL1)	S36	Uniprot
P14543 (NID1)	S333	Uniprot
P14598 (NCF1)	S345	Uniprot
P14598 (NCF1)	S348	Uniprot
P14618 (PKM)	S37	Uniprot
P14635 (CCNB1)	S126	Uniprot
P14635 (CCNB1)	S128	Uniprot
P14784 (IL2RB)	T476	Uniprot
P14921 (ETS1)	T38	Uniprot
P15036 (ETS2)	T72	Uniprot
P15056 (BRAF)	S151	Uniprot
P15056 (BRAF)	T401	Uniprot
P15056 (BRAF)	S750	Uniprot
P15056 (BRAF)	T753	Uniprot
P15336 (ATF2)	T69	Uniprot
P15336 (ATF2)	T71	Uniprot
P15336 (ATF2)	S90	Uniprot
P15391-1 (CD19)	Y348	Uniprot
P15391-1 (CD19)	Y378	Uniprot
P15391-1 (CD19)	Y409	Uniprot
P15391-1 (CD19)	Y439	Uniprot
P15923-2 (TCF3)	S352	Uniprot
P15923-2 (TCF3)	T355	Uniprot
P15923-2 (TCF3)	S359	Uniprot
P16220 (CREB1)	S133	Uniprot
P16949 (STMN1)	S25	Uniprot
P16949 (STMN1)	S38	Uniprot
P17252 (PRKCA)	T638	Uniprot
P17302 (GJA1)	S255	Uniprot
P17302 (GJA1)	S279	Uniprot
P17302 (GJA1)	S282	Uniprot
P17480 (UBTF)	T117	Uniprot
P17480 (UBTF)	T201	Uniprot
P17535 (JUND)	S100	Uniprot
P17655 (CAPN2)	S50	Uniprot
P17676 (CEBPB)	T235	Uniprot
P17861 (XBP1)	S68	Uniprot
P17861 (XBP1)	S181	Uniprot
P19419 (ELK1)	S383	Uniprot
P19419 (ELK1)	S389	Uniprot
P19438-1 (TNFRSF1A)	S274	Uniprot
P19438-1 (TNFRSF1A)	T280	Uniprot
P19484 (TFEB)	S142	Uniprot
P19525 (EIF2AK2)	T451	Uniprot
P19634 (SLC9A1)	S693	Uniprot
P19634-1 (SLC9A1)	S766	Uniprot
P19634 (SLC9A1)	S770	Uniprot
P19634-1 (SLC9A1)	T779	Uniprot
P19634-1 (SLC9A1)	S785	Uniprot
P19793 (RXRA)	S260	Uniprot
P19878 (NCF2)	T233	Uniprot
P22736-1 (NR4A1)	T143	Uniprot
P22736 (NR4A1)	S431	Uniprot
P23396 (RPS3)	T42	Uniprot
P23396 (RPS3)	T221	Uniprot
P23443 (RPS6KB1)	S434	Uniprot
P23443 (RPS6KB1)	T444	Uniprot
P23443 (RPS6KB1)	S447	Uniprot
P24046-1 (GABRR1)	T394	Uniprot
P24046-1 (GABRR1)	S435	Uniprot
P24046-1 (GABRR1)	S440	Uniprot
P24928 (POLR2A)	S1619	Uniprot
P24928 (POLR2A)	S1626	Uniprot
P24928 (POLR2A)	S1647	Uniprot
P24928 (POLR2A)	S1654	Uniprot
P24928 (POLR2A)	S1668	Uniprot
P24928 (POLR2A)	S1675	Uniprot
P24928 (POLR2A)	S1696	Uniprot
P24928 (POLR2A)	S1717	Uniprot
P24928 (POLR2A)	S1724	Uniprot
P24928 (POLR2A)	S1738	Uniprot
P24928 (POLR2A)	S1766	Uniprot
P24928 (POLR2A)	S1787	Uniprot
P24928 (POLR2A)	S1864	Uniprot
P24928 (POLR2A)	S1871	Uniprot
P24928 (POLR2A)	S1878	Uniprot
P24928 (POLR2A)	S1892	Uniprot
P24928 (POLR2A)	S1899	Uniprot
P24928 (POLR2A)	S1913	Uniprot
P24928 (POLR2A)	S1920	Uniprot
P24928 (POLR2A)	S1927	Uniprot
P24928 (POLR2A)	S1934	Uniprot
P24928 (POLR2A)	S1944	Uniprot
P24928 (POLR2A)	S1951	Uniprot
P24941 (CDK2)	T160	Uniprot
P27708 (CAD)	T456	Uniprot
P28482-1 (MAPK1)	S41	Uniprot
P28482-1 (MAPK1)	T185	Uniprot
P28482 (MAPK1)	Y187	Uniprot
P28482 (MAPK1)	T190	Uniprot
P28482 (MAPK1)	S246	Uniprot
P28562 (DUSP1)	S296	Uniprot
P28562 (DUSP1)	S323	Uniprot
P28562 (DUSP1)	S359	Uniprot
P28562 (DUSP1)	S364	Uniprot
P29590-4 (PML)	T28	Uniprot
P29590 (PML)	S36	Uniprot
P29590 (PML)	S38	Uniprot
P29590 (PML)	S40	Uniprot
P29590 (PML)	S527	Uniprot
P29590-4 (PML)	S530	Uniprot
P30041 (PRDX6)	T177	Uniprot
P30307 (CDC25C)	S216	Uniprot
P31645 (SLC6A4)	T616	Uniprot
P31749 (AKT1)	S473	Uniprot
P31943 (HNRNPH1)	S104	Uniprot
P32004 (L1CAM)	S1204	Uniprot
P32004 (L1CAM)	S1248	Uniprot
P32121 (ARRB2)	S14	Uniprot
P32121 (ARRB2)	T276	Uniprot
P33076 (CIITA)	S280	Uniprot
P33076 (CIITA)	S288	Uniprot
P33981 (TTK)	S821	Uniprot
P35236 (PTPN7)	T66	Uniprot
P35236 (PTPN7)	S93	Uniprot
P35236-2 (PTPN7)	T105	Uniprot
P35236-2 (PTPN7)	S132	Uniprot
P35398-4 (RORA)	T128	Uniprot
P35398 (RORA)	T183	Uniprot
P35568 (IRS1)	S312	Uniprot
P35568 (IRS1)	S616	Uniprot
P35568 (IRS1)	S636	Uniprot
P35568 (IRS1)	S639	Uniprot
P35658 (NUP214)	S1710	Uniprot
P35658 (NUP214)	S1809	Uniprot
P36956-3 (SREBF1)	T81	Uniprot
P36956-3 (SREBF1)	S93	Uniprot
P36956 (SREBF1)	S117	Uniprot
P36956-4 (SREBF1)	S147	Uniprot
P37231-2 (PPARG)	S84	Uniprot
P37231 (PPARG)	S112	Uniprot
P38936 (CDKN1A)	T57	Uniprot
P38936 (CDKN1A)	S130	Uniprot
P40763-2 (STAT3)	S726	Uniprot
P40763 (STAT3)	S727	Uniprot
P41162 (ETV3)	S139	Uniprot
P41182 (BCL6)	S333	Uniprot
P41182 (BCL6)	S343	Uniprot
P42224 (STAT1)	S727	Uniprot
P42229 (STAT5A)	S780	Uniprot
P42702-1 (LIFR)	S1044	Uniprot
P43354 (NR4A2)	S126	Uniprot
P43354 (NR4A2)	T132	Uniprot
P43694 (GATA4)	S105	Uniprot
P46527 (CDKN1B)	S10	Uniprot
P46527 (CDKN1B)	S178	Uniprot
P46527 (CDKN1B)	T187	Uniprot
P46695 (IER3)	T18	Uniprot
P46821 (MAP1B)	S1785	Uniprot
P47712 (PLA2G4A)	S505	Uniprot
P48634 (PRRC2A)	T610	Uniprot
P48634 (PRRC2A)	S1004	Uniprot
P48634 (PRRC2A)	S1219	Uniprot
P49023-2 (PXN)	S83	Uniprot
P49023-2 (PXN)	S126	Uniprot
P49023-2 (PXN)	S130	Uniprot
P49137 (MAPKAPK2)	S9	Uniprot
P49137 (MAPKAPK2)	T25	Uniprot
P49137 (MAPKAPK2)	T222	Uniprot
P49137 (MAPKAPK2)	S272	Uniprot
P49137 (MAPKAPK2)	T334	Uniprot
P49137 (MAPKAPK2)	T338	Uniprot
P49407-2 (ARRB1)	S404	Uniprot
P49407 (ARRB1)	S412	Uniprot
P49418 (AMPH)	S293	Uniprot
P49418 (AMPH)	S295	Uniprot
P49585 (PCYT1A)	S315	Uniprot
P49715 (CEBPA)	S21	Uniprot
P49790 (NUP153)	S257	Uniprot
P49790 (NUP153)	S320	Uniprot
P49790 (NUP153)	S334	Uniprot
P49790 (NUP153)	S338	Uniprot
P49790 (NUP153)	T369	Uniprot
P49790 (NUP153)	T388	Uniprot
P49790 (NUP153)	T413	Uniprot
P49790 (NUP153)	S516	Uniprot
P49790 (NUP153)	S522	Uniprot
P49790 (NUP153)	S529	Uniprot
P49790 (NUP153)	S614	Uniprot
P49795 (RGS19)	S151	Uniprot
P49815-1 (TSC2)	S540	Uniprot
P49815-1 (TSC2)	S664	Uniprot
P49841 (GSK3B)	T43	Uniprot
P50548-1 (ERF)	S161	Uniprot
P50548-1 (ERF)	S246	Uniprot
P50548 (ERF)	S251	Uniprot
P50548 (ERF)	T526	Uniprot
P50616 (TOB1)	S152	Uniprot
P50616 (TOB1)	S154	Uniprot
P50616 (TOB1)	S164	Uniprot
P51168 (SCNN1B)	T615	Uniprot
P51170 (SCNN1G)	T622	Uniprot
P51812 (RPS6KA3)	S386	Uniprot
P51812 (RPS6KA3)	Y488	Uniprot
P51812 (RPS6KA3)	Y529	Uniprot
P52945 (PDX1)	S61	Uniprot
P52945 (PDX1)	S66	Uniprot
P53355-1 (DAPK1)	S734	Uniprot
P53805 (RCAN1)	S167	Uniprot
P55211 (CASP9)	T125	Uniprot
P61978 (HNRNPK)	S284	Uniprot
P68400 (CSNK2A1)	T360	Uniprot
P68400 (CSNK2A1)	S362	Uniprot
P68431 (HIST1H3J)	S29	Uniprot
P78347-2 (GTF2I)	S627	Uniprot
P78347-2 (GTF2I)	S633	Uniprot
P78347 (GTF2I)	S668	Uniprot
P78347 (GTF2I)	S674	Uniprot
P78352 (DLG4)	T287	Uniprot
P78536 (ADAM17)	T735	Uniprot
P78559 (MAP1A)	T2042	Uniprot
P78559 (MAP1A)	S2419	Uniprot
P84022 (SMAD3)	T179	Uniprot
P84022 (SMAD3)	S204	Uniprot
P84022 (SMAD3)	S208	Uniprot
P84022-1 (SMAD3)	S213	Uniprot
P84243 (H3F3B)	S29	Uniprot
Q00587 (CDC42EP1)	S113	Uniprot
Q00587 (CDC42EP1)	S195	Uniprot
Q00613 (HSF1)	S307	Uniprot
Q00975 (CACNA1B)	S411	Uniprot
Q00975 (CACNA1B)	S446	Uniprot
Q01196 (RUNX1)	S249	Uniprot
Q01196 (RUNX1)	S266	Uniprot
Q01196 (RUNX1)	T273	Uniprot
Q01196-8 (RUNX1)	S276	Uniprot
Q01196-8 (RUNX1)	S293	Uniprot
Q01196-8 (RUNX1)	T300	Uniprot
Q01196-8 (RUNX1)	S303	Uniprot
Q01196-8 (RUNX1)	S462	Uniprot
Q01844 (EWSR1)	T79	Uniprot
Q01860 (POU5F1)	S111	Uniprot
Q01860 (POU5F1)	T118	Uniprot
Q01860 (POU5F1)	S355	Uniprot
Q01959 (SLC6A3)	S53	Uniprot
Q02224 (CENPE)	S2605	Uniprot
Q02224 (CENPE)	S2608	Uniprot
Q02224 (CENPE)	S2639	Uniprot
Q02224 (CENPE)	S2654	Uniprot
Q02447 (SP3)	S73	Uniprot
Q02641 (CACNB1)	S161	Uniprot
Q02641 (CACNB1)	S348	Uniprot
Q02750 (MAP2K1)	T286	Uniprot
Q02750 (MAP2K1)	T292	Uniprot
Q02750 (MAP2K1)	T386	Uniprot
Q02952 (AKAP12)	S286	Uniprot
Q04206 (RELA)	T435	Uniprot
Q04637-8 (EIF4G1)	S1232	Uniprot
Q05209 (PTPN12)	S571	Uniprot
Q05397 (PTK2)	S910	Uniprot
Q05469-1 (LIPE)	T891	Uniprot
Q05682-4 (CALD1)	S534	Uniprot
Q05682 (CALD1)	S759	Uniprot
Q05682 (CALD1)	S789	Uniprot
Q07343-2 (PDE4B)	S487	Uniprot
Q07343 (PDE4B)	S659	Uniprot
Q07666 (KHDRBS1)	S58	Uniprot
Q07666 (KHDRBS1)	T72	Uniprot
Q07666-1 (KHDRBS1)	T84	Uniprot
Q07812 (BAX)	T167	Uniprot
Q07820 (MCL1)	T163	Uniprot
Q07866 (KLC1)	S460	Uniprot
Q07869-1 (PPARA)	S12	Uniprot
Q07869 (PPARA)	S21	Uniprot
Q07889 (SOS1)	S1132	Uniprot
Q07889-1 (SOS1)	S1167	Uniprot
Q07889-1 (SOS1)	S1178	Uniprot
Q07889 (SOS1)	S1193	Uniprot
Q07889-1 (SOS1)	S1197	Uniprot
Q08493-2 (PDE4C)	S535	Uniprot
Q08493 (PDE4C)	S641	Uniprot
Q08499-5 (PDE4D)	S413	Uniprot
Q08499-4 (PDE4D)	S490	Uniprot
Q08499-2 (PDE4D)	S579	Uniprot
Q08499 (PDE4D)	S715	Uniprot
Q09472 (EP300)	T317	Uniprot
Q09472 (EP300)	T938	Uniprot
Q09472 (EP300)	S1038	Uniprot
Q09472 (EP300)	T1960	Uniprot
Q09472 (EP300)	S2039	Uniprot
Q09472 (EP300)	S2279	Uniprot
Q09472 (EP300)	S2315	Uniprot
Q09472 (EP300)	S2366	Uniprot
Q09666 (AHNAK)	S216	Uniprot
Q09666 (AHNAK)	T694	Uniprot
Q09666 (AHNAK)	S5099	Uniprot
Q09666 (AHNAK)	S5110	Uniprot
Q09666 (AHNAK)	T5794	Uniprot
Q12772 (SREBF2)	S432	Uniprot
Q12772 (SREBF2)	S455	Uniprot
Q12778 (FOXO1)	S246	Uniprot
Q12778 (FOXO1)	S413	Uniprot
Q12778 (FOXO1)	S418	Uniprot
Q12778 (FOXO1)	S429	Uniprot
Q12778 (FOXO1)	S470	Uniprot
Q12778 (FOXO1)	T478	Uniprot
Q12778 (FOXO1)	T560	Uniprot
Q12800 (TFCP2)	S291	Uniprot
Q12800 (TFCP2)	S309	Uniprot
Q13153 (PAK1)	T212	Uniprot
Q13164 (MAPK7)	T733	Uniprot
Q13285 (NR5A1)	S203	Uniprot
Q13322-3 (GRB10)	S92	Uniprot
Q13322 (GRB10)	S150	Uniprot
Q13322-3 (GRB10)	S360	Uniprot
Q13322-2 (GRB10)	S372	Uniprot
Q13322 (GRB10)	S418	Uniprot
Q13322-2 (GRB10)	S430	Uniprot
Q13322 (GRB10)	S476	Uniprot
Q13362 (PPP2R5C)	S337	Uniprot
Q13409 (DYNC1I2)	S87	Uniprot
Q13459 (MYO9B)	T1346	Uniprot
Q13480-1 (GAB1)	T312	Uniprot
Q13480-2 (GAB1)	S381	Uniprot
Q13480 (GAB1)	S454	Uniprot
Q13480 (GAB1)	T476	Uniprot
Q13480-1 (GAB1)	S551	Uniprot
Q13480-1 (GAB1)	S567	Uniprot
Q13480-2 (GAB1)	S581	Uniprot
Q13480 (GAB1)	S582	Uniprot
Q13480-2 (GAB1)	S597	Uniprot
Q13485 (SMAD4)	T277	Uniprot
Q13541 (EIF4EBP1)	T37	Uniprot
Q13541 (EIF4EBP1)	T45	Uniprot
Q13541 (EIF4EBP1)	T46	Uniprot
Q13541 (EIF4EBP1)	S65	Uniprot
Q13541 (EIF4EBP1)	T70	Uniprot
Q13541 (EIF4EBP1)	S83	Uniprot
Q13562 (NEUROD1)	S162	Uniprot
Q13562 (NEUROD1)	S259	Uniprot
Q13562 (NEUROD1)	S266	Uniprot
Q13562 (NEUROD1)	S274	Uniprot
Q13586 (STIM1)	S575	Uniprot
Q13586 (STIM1)	S608	Uniprot
Q13586 (STIM1)	S621	Uniprot
Q13614 (MTMR2)	S58	Uniprot
Q13625 (TP53BP2)	T586	Uniprot
Q13625 (TP53BP2)	S827	Uniprot
Q14005 (IL16)	S845	Uniprot
Q14151 (SAFB2)	S343	Uniprot
Q14157-1 (UBAP2L)	T844	Uniprot
Q14185 (DOCK1)	T1772	Uniprot
Q14247 (CTTN)	S405	Uniprot
Q14247 (CTTN)	S418	Uniprot
Q14643 (ITPR1)	S436	Uniprot
Q14643 (ITPR1)	S1774	Uniprot
Q14654 (KCNJ11)	T341	Uniprot
Q14654 (KCNJ11)	S385	Uniprot
Q14674 (ESPL1)	S1126	Uniprot
Q14686 (NCOA6)	S884	Uniprot
Q14790 (CASP8)	S387	Uniprot
Q14934 (NFATC4)	S676	Uniprot
Q15366 (PCBP2)	S173	Uniprot
Q15366 (PCBP2)	S189	Uniprot
Q15366 (PCBP2)	T213	Uniprot
Q15366 (PCBP2)	S272	Uniprot
Q15398 (DLGAP5)	T329	Uniprot
Q15418-1 (RPS6KA1)	T359	Uniprot
Q15418-1 (RPS6KA1)	S363	Uniprot
Q15418-2 (RPS6KA1)	T368	Uniprot
Q15418-2 (RPS6KA1)	S372	Uniprot
Q15418 (RPS6KA1)	T573	Uniprot
Q15596 (NCOA2)	S736	Uniprot
Q15648 (MED1)	T1032	Uniprot
Q15648 (MED1)	T1457	Uniprot
Q15672 (TWIST1)	S6	Uniprot
Q15672 (TWIST1)	S68	Uniprot
Q15700 (DLG2)	S323	Uniprot
Q15746 (MYLK)	S1779	Uniprot
Q15788-3 (NCOA1)	S395	Uniprot
Q15788-2 (NCOA1)	T1179	Uniprot
Q15788 (NCOA1)	S1185	Uniprot
Q15796 (SMAD2)	T220	Uniprot
Q15796 (SMAD2)	S245	Uniprot
Q15796 (SMAD2)	S250	Uniprot
Q15796 (SMAD2)	S255	Uniprot
Q15797 (SMAD1)	S187	Uniprot
Q15797 (SMAD1)	S195	Uniprot
Q15797-1 (SMAD1)	S206	Uniprot
Q15797 (SMAD1)	S214	Uniprot
Q15831 (STK11)	S428	Uniprot
Q16526 (CRY1)	S247	Uniprot
Q16665 (HIF1A)	S641	Uniprot
Q16665 (HIF1A)	S643	Uniprot
Q16690 (DUSP5)	T321	Uniprot
Q16690 (DUSP5)	S346	Uniprot
Q16690 (DUSP5)	S376	Uniprot
Q16828 (DUSP6)	S159	Uniprot
Q16828 (DUSP6)	S197	Uniprot
Q49AN0 (CRY2)	S266	Uniprot
Q53EZ4 (CEP55)	S425	Uniprot
Q53EZ4 (CEP55)	S428	Uniprot
Q5SW79 (CEP170)	T565	Uniprot
Q5VZ89 (DENND4C)	S989	Uniprot
Q6P0Q8 (MAST2)	S1337	Uniprot
Q6P996 (PDXDC1)	T691	Uniprot
Q6PKG0 (LARP1)	T303	Uniprot
Q6PKG0 (LARP1)	S774	Uniprot
Q6Y7W6 (GIGYF2)	S30	Uniprot
Q6ZS17 (RIPOR1)	S351	Uniprot
Q70E73 (RAPH1)	S610	Uniprot
Q7L5N1 (COPS6)	S148	Uniprot
Q7LDG7 (RASGRP2)	S394	Uniprot
Q7Z5J4 (RAI1)	T1068	Uniprot
Q86UC2 (RSPH3)	T286	Uniprot
Q86UR1 (NOXA1)	S239	Uniprot
Q86UR1 (NOXA1)	S282	Uniprot
Q86UU1 (PHLDB1)	S443	Uniprot
Q86UU1 (PHLDB1)	S461	Uniprot
Q86WB0 (ZC3HC1)	S354	Uniprot
Q86WB0 (ZC3HC1)	S359	Uniprot
Q8IUW5 (RELL1)	T261	Uniprot
Q8IUX7 (AEBP1)	T621	Uniprot
Q8IUX7 (AEBP1)	T1012	Uniprot
Q8IVF2 (AHNAK2)	T510	Uniprot
Q8IVT5-4 (KSR1)	T137	Uniprot
Q8IVT5-4 (KSR1)	T151	Uniprot
Q8IVT5-4 (KSR1)	S320	Uniprot
Q8IW41 (MAPKAPK5)	T182	Uniprot
Q8IX03 (WWC1)	S542	Uniprot
Q8IX03 (WWC1)	S548	Uniprot
Q8IYB8 (SUPV3L1)	S725	Uniprot
Q8IZP0 (ABI1)	S183	Uniprot
Q8IZP0 (ABI1)	S216	Uniprot
Q8IZP0 (ABI1)	S222	Uniprot
Q8IZP0 (ABI1)	S225	Uniprot
Q8IZP0 (ABI1)	T265	Uniprot
Q8IZP0 (ABI1)	S267	Uniprot
Q8IZP0 (ABI1)	S392	Uniprot
Q8IZP0 (ABI1)	T394	Uniprot
Q8IZP0 (ABI1)	S410	Uniprot
Q8IZQ8 (MYOCD)	S815	Uniprot
Q8IZQ8 (MYOCD)	S862	Uniprot
Q8IZQ8 (MYOCD)	S869	Uniprot
Q8IZQ8 (MYOCD)	T896	Uniprot
Q8N122 (RPTOR)	S8	Uniprot
Q8N122 (RPTOR)	S696	Uniprot
Q8N122 (RPTOR)	S863	Uniprot
Q8N1G1 (REXO1)	T269	Uniprot
Q8N9N5 (BANP)	T337	Uniprot
Q8N9N5 (BANP)	T352	Uniprot
Q8NEL9 (DDHD1)	S727	Uniprot
Q8NHW3 (MAFA)	S14	Uniprot
Q8NHW3 (MAFA)	S65	Uniprot
Q8TDM6 (DLG5)	T1279	Uniprot
Q8TER0 (SNED1)	T1239	Uniprot
Q8WX93 (PALLD)	S688	Uniprot
Q8WX93 (PALLD)	S808	Uniprot
Q92731 (ESR2)	S105	Uniprot
Q92793 (CREBBP)	S93	Uniprot
Q92908 (GATA6)	S266	Uniprot
Q92934 (BAD)	S75	Uniprot
Q92974 (ARHGEF2)	T679	Uniprot
Q93062 (RBPMS)	T118	Uniprot
Q969H0 (FBXW7)	T205	Uniprot
Q969V6 (MRTFA)	S454	Uniprot
Q96BY7 (ATG2B)	T398	Uniprot
Q96EP5 (DAZAP1)	T269	Uniprot
Q96EP5 (DAZAP1)	T315	Uniprot
Q96FF9 (CDCA5)	S79	Uniprot
Q96FF9 (CDCA5)	S209	Uniprot
Q96I25 (RBM17)	T71	Uniprot
Q96I25 (RBM17)	S222	Uniprot
Q96LC9 (BMF)	S74	Uniprot
Q96LC9 (BMF)	S77	Uniprot
Q96LL9 (DNAJC30)	S137	Uniprot
Q96PE2 (ARHGEF17)	T702	Uniprot
Q96PH1-4 (NOX5)	S498	Uniprot
Q96PH1 (NOX5)	S544	Uniprot
Q96Q27 (ASB2)	S323	Uniprot
Q96RK0 (CIC)	S1389	Uniprot
Q96RK0 (CIC)	S1409	Uniprot
Q96RS0 (TGS1)	S298	Uniprot
Q96SB3 (PPP1R9B)	S15	Uniprot
Q9BQG0 (MYBBP1A)	S1267	Uniprot
Q9BQQ3 (GORASP1)	S274	Uniprot
Q9BUB5 (MKNK1)	T255	Uniprot
Q9BWW4 (SSBP3)	T360	Uniprot
Q9BY84-1 (DUSP16)	S446	Uniprot
Q9BZI1 (IRX2)	S46	Uniprot
Q9BZI1 (IRX2)	S64	Uniprot
Q9C0C2 (TNKS1BP1)	T131	Uniprot
Q9C0C2 (TNKS1BP1)	T1032	Uniprot
Q9C0D5 (TANC1)	S1564	Uniprot
Q9GZM8 (NDEL1)	T219	Uniprot
Q9GZM8 (NDEL1)	T245	Uniprot
Q9H0D6 (XRN2)	T439	Uniprot
Q9H8Y8 (GORASP2)	T222	Uniprot
Q9H8Y8 (GORASP2)	T225	Uniprot
Q9H9S0 (NANOG)	S52	Uniprot
Q9H9S0 (NANOG)	S71	Uniprot
Q9H9S0 (NANOG)	T78	Uniprot
Q9HBH9 (MKNK2)	S43	Uniprot
Q9HBH9 (MKNK2)	S74	Uniprot
Q9HBH9 (MKNK2)	S220	Uniprot
Q9HBH9 (MKNK2)	T379	Uniprot
Q9HBH9 (MKNK2)	S440	Uniprot
Q9HBH9 (MKNK2)	S452	Uniprot
Q9NQ66 (PLCB1)	S982	Uniprot
Q9NQC3 (RTN4)	T172	Uniprot
Q9NRA0 (SPHK2)	S387	Uniprot
Q9NRA0 (SPHK2)	T614	Uniprot
Q9NRA8 (EIF4ENIF1)	S115	Uniprot
Q9NRF2 (SH2B1)	S96	Uniprot
Q9NSI2 (FAM207A)	S39	Uniprot
Q9NUY8 (TBC1D23)	T514	Uniprot
Q9NXR1 (NDE1)	T215	Uniprot
Q9NXR1 (NDE1)	S239	Uniprot
Q9NYA1 (SPHK1)	S225	Uniprot
Q9NYZ3 (GTSE1)	S461	Uniprot
Q9NZ72 (STMN3)	S68	Uniprot
Q9NZV8 (KCND2)	T602	Uniprot
Q9NZV8 (KCND2)	T607	Uniprot
Q9NZV8 (KCND2)	S616	Uniprot
Q9P0K7 (RAI14)	T249	Uniprot
Q9UBN7 (HDAC6)	T1031	Uniprot
Q9UHB6 (LIMA1)	S362	Uniprot
Q9UHB6 (LIMA1)	S604	Uniprot
Q9UKX7 (NUP50)	S221	Uniprot
Q9UKX7 (NUP50)	S315	Uniprot
Q9ULC4 (MCTS1)	T81	Uniprot
Q9ULW0 (TPX2)	T369	Uniprot
Q9UNA1 (ARHGAP26)	S685	Uniprot
Q9UPT5 (EXOC7)	S250	Uniprot
Q9UQC2 (GAB2)	S623	Uniprot
Q9Y463 (DYRK1B)	S421	Uniprot
Q9Y4F5 (CEP170B)	S969	Uniprot
Q9Y4H2 (IRS2)	T657	Uniprot
Q9Y4K1 (CRYBG1)	S675	Uniprot
Q9Y698 (CACNG2)	T321	Uniprot
Q9Y6G9 (DYNC1LI1)	S516	Uniprot
Q9Y6W5 (WASF2)	S296	Uniprot
Q9Y6W5 (WASF2)	S308	Uniprot

IMPORTANT: For western blots, incubate membrane with diluted antibody in 5% w/v milk, 1X TBS, 0.1% Tween®20 at 4°C with gentle shaking, overnight.

Secondary antibody Goat Anti-Rabbit IgG (H+L) HRP (S0001) Goat Anti-Rabbit IgG (H+L) AP (S0003) Goat Anti-Rabbit IgG (H+L) Fluor594-conjugated (S0006) Goat Anti-Rabbit IgG (H+L) FITC-conjugated (S0008) Goat Anti-Rabbit IgG (H+L) CY3-conjugated (S0011) Goat Anti-Rabbit IgG (H+L) Fluor647-conjugated (S0013) Goat Anti-Rabbit IgG (H+L) TRITC-conjugated (S0015) Goat Anti-Rabbit IgG (H+L) Fluor488-conjugated (S0018)

首页 / Primary antibody / Phospho-ERK1/2 (Thr202/Tyr204) Antibody

Phospho-ERK1/2 (Thr202/Tyr204) Antibody - AF1015

相关产品推荐

产品信息

别名:Expand▼

应用:

反应性:

预测反应:

来源:

克隆性:

纯化:

特异性:

RRID:

形式:

浓度:

保存条件:

免疫原

Immunogen:

Uniprot:

Gene ID:

Gene Name:

Molecular Weight:

Subcellular Location:

Description:

Sequence:

研究背景

Function:

Post-translational Modifications:

Subcellular Location:

Subunit Structure:

Similarity:

Function:

Post-translational Modifications:

Subcellular Location:

Subunit Structure:

Similarity:

研究领域

Research Fields:

实验方案

WB Images(2)

IHC Images(6)

IF/ICC Images(1)

Peptide-ELISA

Reference Citations:

评论提交

Catalog Number :

Price/Size :

Function :

Format and storage :

Precautions :

P27361/P28482 as Substrate

P27361/P28482 as PTM Enzyme

首页 `/` Primary antibody `/` Phospho-ERK1/2 (Thr202/Tyr204) Antibody