Phospho-ERK1/2 (Thr202/Tyr204) Antibody - AF1015
-
- 名 称:
- 磷酸化 ERK1/2 (Thr202/Tyr204) 抗体
-
- 货 号:
- AF1015
-
- RRID:
- AB_2834432
-
- 来 源:
- Rabbit
-
- 应 用:
- WB,IHC,IF/ICC,ELISA
-
- 反 应:
- Human, Mouse, Rat
-
- 预 测:
- Pig(100%), Zebrafish(100%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%)
-
- 蛋白号:
-
- 分子量:
- 42,44kD;
43kDa,41kDa(Calculated). -
- 浓 度:
- 1mg/ml
相关产品推荐
产品信息
别名:Expand▼
ERK 1; ERK; ERK-1; ERK1; ERT 2; ERT2; Extracellular Signal Regulated Kinase 1; Extracellular signal related kinase 1; Extracellular signal-regulated kinase 1; HGNC6877; HS44KDAP; HUMKER1A; Insulin Stimulated MAP2 Kinase; Insulin-stimulated MAP2 kinase; MAP kinase 1; MAP kinase 3; MAP Kinase; MAP kinase isoform p44; MAPK 1; MAPK 3; MAPK; MAPK1; Mapk3; MGC20180; Microtubule Associated Protein 2 Kinase; Microtubule-associated protein 2 kinase; Mitogen Activated Protein Kinase 3; Mitogen-activated protein kinase 1; Mitogen-activated protein kinase 3; MK03_HUMAN; OTTHUMP00000174538; OTTHUMP00000174541; p44 ERK1; p44 MAPK; p44-ERK1; p44-MAPK; P44ERK1; P44MAPK; PRKM 3; PRKM3; Protein Kinase Mitogen Activated 3; ERK 2; ERK; ERK-2; ERT1; Extracellular Signal Regulated Kinase 2; Extracellular signal-regulated kinase 2; MAP kinase 1; MAP kinase 2; MAP kinase isoform p42; MAPK 1; MAPK 2; Mapk1; MAPK2; Mitogen-activated protein kinase 1; Mitogen-activated protein kinase 2; MK01_HUMAN; P38; P40; P41; p42-MAPK; P42MAPK; PRKM1; PRKM2; protein kinase, mitogen-activated, 1; protein kinase, mitogen-activated, 2; protein tyrosine kinase ERK2;
应用:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:200, ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.
反应性:
Human, Mouse, Rat
预测反应:
Pig(100%), Zebrafish(100%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%)
来源:
Rabbit
克隆性:
Polyclonal
纯化:
The antibody is from purified rabbit serum by affinity purification via sequential chromatography on phospho-peptide and non-phospho-peptide affinity columns.
特异性:
Phospho-ERK1/2 (Thr202/Tyr204) Antibody detects endogenous levels of ERK1/2 only when phosphorylated at Threonine 202/Tyrosine 204.
免疫原:
A synthesized peptide derived from human ERK1/2 around the phosphorylation site of Thr202/Tyr204.
RRID:
AB_2834432
引用格式: Affinity Biosciences Cat# AF1015, RRID:AB_2834432.
形式:
Liquid
浓度:
1mg/ml
保存条件:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.Store at -20 °C.Stable for 12 months from date of receipt.
免疫原
Immunogen:
A synthesized peptide derived from human ERK1/2 around the phosphorylation site of Thr202/Tyr204.
Uniprot:
>>Visit The Human Protein Atlas
Gene ID:
Gene Name:
MAPK3,MAPK1
Molecular Weight:
Observed Mol.Wt.: 42,44kD.
Predicted Mol.Wt.: 43kDa,41kDa(Calculated)..
Subcellular Location:
Nucleus.
Description:
Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway. MAPK1/ERK2 and MAPK3/ERK1 are the 2 MAPKs which play an important role in the MAPK/ERK cascade. They participate also in a signaling cascade initiated by activated KIT and KITLG/SCF. Depending on the cellular context, the MAPK/ERK cascade mediates diverse biological functions such as cell growth, adhesion, survival and differentiation through the regulation of transcription, translation, cytoskeletal rearrangements. Publishing reference https://www.spandidos-publications.com/10.3892/mmr.2016.5305/download http://www.sciencedirect.com/science/article/pii/S0306452216000464 http://www.sciencedirect.com/science/article/pii/S0171298514002782 https://www.spandidos-publications.com/etm/12/1/499/download
Sequence:
- P27361 MK03_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAAAAAQGGGGGEPRRTEGVGPGVPGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVYIVQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERLKELIFQETARFQPGVLEAP
- P28482 MK01_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
研究背景
Function:
Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway. MAPK1/ERK2 and MAPK3/ERK1 are the 2 MAPKs which play an important role in the MAPK/ERK cascade. They participate also in a signaling cascade initiated by activated KIT and KITLG/SCF. Depending on the cellular context, the MAPK/ERK cascade mediates diverse biological functions such as cell growth, adhesion, survival and differentiation through the regulation of transcription, translation, cytoskeletal rearrangements. The MAPK/ERK cascade plays also a role in initiation and regulation of meiosis, mitosis, and postmitotic functions in differentiated cells by phosphorylating a number of transcription factors. About 160 substrates have already been discovered for ERKs. Many of these substrates are localized in the nucleus, and seem to participate in the regulation of transcription upon stimulation. However, other substrates are found in the cytosol as well as in other cellular organelles, and those are responsible for processes such as translation, mitosis and apoptosis. Moreover, the MAPK/ERK cascade is also involved in the regulation of the endosomal dynamics, including lysosome processing and endosome cycling through the perinuclear recycling compartment (PNRC); as well as in the fragmentation of the Golgi apparatus during mitosis. The substrates include transcription factors (such as ATF2, BCL6, ELK1, ERF, FOS, HSF4 or SPZ1), cytoskeletal elements (such as CANX, CTTN, GJA1, MAP2, MAPT, PXN, SORBS3 or STMN1), regulators of apoptosis (such as BAD, BTG2, CASP9, DAPK1, IER3, MCL1 or PPARG), regulators of translation (such as EIF4EBP1) and a variety of other signaling-related molecules (like ARHGEF2, FRS2 or GRB10). Protein kinases (such as RAF1, RPS6KA1/RSK1, RPS6KA3/RSK2, RPS6KA2/RSK3, RPS6KA6/RSK4, SYK, MKNK1/MNK1, MKNK2/MNK2, RPS6KA5/MSK1, RPS6KA4/MSK2, MAPKAPK3 or MAPKAPK5) and phosphatases (such as DUSP1, DUSP4, DUSP6 or DUSP16) are other substrates which enable the propagation the MAPK/ERK signal to additional cytosolic and nuclear targets, thereby extending the specificity of the cascade.
Post-translational Modifications:
Phosphorylated upon KIT and FLT3 signaling (By similarity). Dually phosphorylated on Thr-202 and Tyr-204, which activates the enzyme. Ligand-activated ALK induces tyrosine phosphorylation. Dephosphorylated by PTPRJ at Tyr-204.
Subcellular Location:
Cytoplasm. Nucleus. Membrane>Caveola.
Note: Autophosphorylation at Thr-207 promotes nuclear localization.
Subunit Structure:
Binds both upstream activators and downstream substrates in multimolecular complexes. Found in a complex with at least BRAF, HRAS, MAP2K1/MEK1, MAPK3 and RGS14 (By similarity). Interacts with ADAM15, ARRB2, CANX, DAPK1 (via death domain), HSF4, IER3, MAP2K1/MEK1, MORG1, NISCH, and SGK1. Interacts with PEA15 and MKNK2 (By similarity). MKNK2 isoform 1 binding prevents from dephosphorylation and inactivation (By similarity). Interacts with TPR. Interacts with CDKN2AIP. Interacts with HSF1 (via D domain and preferentially with hyperphosphorylated form); this interaction occurs upon heat shock. Interacts with CAVIN4 (By similarity).
(Microbial infection) Binds to HIV-1 Nef through its SH3 domain. This interaction inhibits its tyrosine-kinase activity.
Similarity:
The TXY motif contains the threonine and tyrosine residues whose phosphorylation activates the MAP kinases.
Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily.
Function:
Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway. MAPK1/ERK2 and MAPK3/ERK1 are the 2 MAPKs which play an important role in the MAPK/ERK cascade. They participate also in a signaling cascade initiated by activated KIT and KITLG/SCF. Depending on the cellular context, the MAPK/ERK cascade mediates diverse biological functions such as cell growth, adhesion, survival and differentiation through the regulation of transcription, translation, cytoskeletal rearrangements. The MAPK/ERK cascade plays also a role in initiation and regulation of meiosis, mitosis, and postmitotic functions in differentiated cells by phosphorylating a number of transcription factors. About 160 substrates have already been discovered for ERKs. Many of these substrates are localized in the nucleus, and seem to participate in the regulation of transcription upon stimulation. However, other substrates are found in the cytosol as well as in other cellular organelles, and those are responsible for processes such as translation, mitosis and apoptosis. Moreover, the MAPK/ERK cascade is also involved in the regulation of the endosomal dynamics, including lysosome processing and endosome cycling through the perinuclear recycling compartment (PNRC); as well as in the fragmentation of the Golgi apparatus during mitosis. The substrates include transcription factors (such as ATF2, BCL6, ELK1, ERF, FOS, HSF4 or SPZ1), cytoskeletal elements (such as CANX, CTTN, GJA1, MAP2, MAPT, PXN, SORBS3 or STMN1), regulators of apoptosis (such as BAD, BTG2, CASP9, DAPK1, IER3, MCL1 or PPARG), regulators of translation (such as EIF4EBP1) and a variety of other signaling-related molecules (like ARHGEF2, DCC, FRS2 or GRB10). Protein kinases (such as RAF1, RPS6KA1/RSK1, RPS6KA3/RSK2, RPS6KA2/RSK3, RPS6KA6/RSK4, SYK, MKNK1/MNK1, MKNK2/MNK2, RPS6KA5/MSK1, RPS6KA4/MSK2, MAPKAPK3 or MAPKAPK5) and phosphatases (such as DUSP1, DUSP4, DUSP6 or DUSP16) are other substrates which enable the propagation the MAPK/ERK signal to additional cytosolic and nuclear targets, thereby extending the specificity of the cascade. Mediates phosphorylation of TPR in respons to EGF stimulation. May play a role in the spindle assembly checkpoint. Phosphorylates PML and promotes its interaction with PIN1, leading to PML degradation. Phosphorylates CDK2AP2 (By similarity).
Acts as a transcriptional repressor. Binds to a [GC]AAA[GC] consensus sequence. Repress the expression of interferon gamma-induced genes. Seems to bind to the promoter of CCL5, DMP1, IFIH1, IFITM1, IRF7, IRF9, LAMP3, OAS1, OAS2, OAS3 and STAT1. Transcriptional activity is independent of kinase activity.
Post-translational Modifications:
Phosphorylated upon KIT and FLT3 signaling (By similarity). Dually phosphorylated on Thr-185 and Tyr-187, which activates the enzyme. Undergoes regulatory phosphorylation on additional residues such as Ser-246 and Ser-248 in the kinase insert domain (KID) These phosphorylations, which are probably mediated by more than one kinase, are important for binding of MAPK1/ERK2 to importin-7 (IPO7) and its nuclear translocation. In addition, autophosphorylation of Thr-190 was shown to affect the subcellular localization of MAPK1/ERK2 as well. Ligand-activated ALK induces tyrosine phosphorylation. Dephosphorylated by PTPRJ at Tyr-187. Phosphorylation on Ser-29 by SGK1 results in its activation by enhancing its interaction with MAP2K1/MEK1 and MAP2K2/MEK2. DUSP3 and DUSP6 dephosphorylate specifically MAPK1/ERK2 and MAPK3/ERK1 whereas DUSP9 dephosphorylates a broader range of MAPKs. Dephosphorylated by DUSP1 at Thr-185 and Tyr-187.
ISGylated.
Subcellular Location:
Cytoplasm>Cytoskeleton>Spindle. Nucleus. Cytoplasm>Cytoskeleton>Microtubule organizing center>Centrosome. Cytoplasm. Membrane>Caveola.
Note: Associated with the spindle during prometaphase and metaphase (By similarity). PEA15-binding and phosphorylated DAPK1 promote its cytoplasmic retention. Phosphorylation at Ser- 246 and Ser-248 as well as autophosphorylation at Thr-190 promote nuclear localization.
Subunit Structure:
Binds both upstream activators and downstream substrates in multimolecular complexes. This interaction inhibits its tyrosine-kinase activity. Interacts with ADAM15, ARHGEF2, ARRB2, DAPK1 (via death domain), HSF4, IER3, IPO7, DUSP6, NISCH, SGK1, and isoform 1 of NEK2. Interacts (phosphorylated form) with CAV2 ('Tyr-19'-phosphorylated form); the interaction, promoted by insulin, leads to nuclear location and MAPK1 activation. Interacts with MORG1, PEA15 and MKNK2 (By similarity). MKNK2 isoform 1 binding prevents from dephosphorylation and inactivation (By similarity). Interacts with DCC (By similarity). The phosphorylated form interacts with PML (isoform PML-4). Interacts with STYX. Interacts with CDK2AP2. Interacts with CAVIN4 (By similarity). Interacts with DUSP7; the interaction enhances DUSP7 phosphatase activity.
(Microbial infection) Interacts with HIV-1 Nef through its SH3 domain.
Similarity:
The TXY motif contains the threonine and tyrosine residues whose phosphorylation activates the MAP kinases.
Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily.
研究领域
Research Fields:
· Cellular Processes > Cellular community - eukaryotes > Focal adhesion.(View pathway)
· Cellular Processes > Cell growth and death > Oocyte meiosis.(View pathway)
· Cellular Processes > Cellular community - eukaryotes > Gap junction.(View pathway)
· Cellular Processes > Cell growth and death > Apoptosis.(View pathway)
· Cellular Processes > Transport and catabolism > Autophagy - animal.(View pathway)
· Cellular Processes > Cellular community - eukaryotes > Adherens junction.(View pathway)
· Cellular Processes > Cellular community - eukaryotes > Signaling pathways regulating pluripotency of stem cells.(View pathway)
· Cellular Processes > Cell growth and death > Cellular senescence.(View pathway)
· Cellular Processes > Cell motility > Regulation of actin cytoskeleton.(View pathway)
· Environmental Information Processing > Signal transduction > TNF signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > MAPK signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > ErbB signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > Sphingolipid signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > FoxO signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > mTOR signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > Apelin signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > cGMP-PKG signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > Ras signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > TGF-beta signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > HIF-1 signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > Rap1 signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > Phospholipase D signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > cAMP signaling pathway.(View pathway)
· Human Diseases > Cancers: Specific types > Pancreatic cancer.(View pathway)
· Human Diseases > Cancers: Specific types > Renal cell carcinoma.(View pathway)
· Human Diseases > Cancers: Specific types > Thyroid cancer.(View pathway)
· Human Diseases > Cancers: Specific types > Bladder cancer.(View pathway)
· Human Diseases > Cancers: Overview > Pathways in cancer.(View pathway)
· Human Diseases > Cancers: Specific types > Gastric cancer.(View pathway)
· Human Diseases > Cancers: Specific types > Non-small cell lung cancer.(View pathway)
· Human Diseases > Cancers: Specific types > Glioma.(View pathway)
· Human Diseases > Cancers: Specific types > Colorectal cancer.(View pathway)
· Human Diseases > Cancers: Overview > Proteoglycans in cancer.
· Human Diseases > Cancers: Specific types > Hepatocellular carcinoma.(View pathway)
· Human Diseases > Cancers: Specific types > Acute myeloid leukemia.(View pathway)
· Human Diseases > Cancers: Specific types > Endometrial cancer.(View pathway)
· Human Diseases > Endocrine and metabolic diseases > Type II diabetes mellitus.
· Human Diseases > Cancers: Specific types > Breast cancer.(View pathway)
· Human Diseases > Cancers: Specific types > Chronic myeloid leukemia.(View pathway)
· Human Diseases > Infectious diseases: Bacterial > Pertussis.
· Human Diseases > Infectious diseases: Bacterial > Salmonella infection.
· Human Diseases > Cancers: Overview > Central carbon metabolism in cancer.(View pathway)
· Human Diseases > Cancers: Overview > Choline metabolism in cancer.(View pathway)
· Human Diseases > Infectious diseases: Bacterial > Shigellosis.
· Human Diseases > Infectious diseases: Viral > Hepatitis C.
· Human Diseases > Cancers: Overview > Viral carcinogenesis.
· Human Diseases > Infectious diseases: Viral > Hepatitis B.
· Human Diseases > Cancers: Specific types > Melanoma.(View pathway)
· Human Diseases > Infectious diseases: Viral > Human papillomavirus infection.
· Human Diseases > Infectious diseases: Parasitic > Chagas disease (American trypanosomiasis).
· Human Diseases > Drug resistance: Antineoplastic > EGFR tyrosine kinase inhibitor resistance.
· Human Diseases > Infectious diseases: Bacterial > Tuberculosis.
· Human Diseases > Infectious diseases: Viral > Influenza A.
· Human Diseases > Drug resistance: Antineoplastic > Platinum drug resistance.
· Human Diseases > Infectious diseases: Parasitic > Leishmaniasis.
· Human Diseases > Substance dependence > Alcoholism.
· Human Diseases > Neurodegenerative diseases > Prion diseases.
· Human Diseases > Neurodegenerative diseases > Alzheimer's disease.(View pathway)
· Human Diseases > Infectious diseases: Parasitic > Toxoplasmosis.
· Human Diseases > Drug resistance: Antineoplastic > Endocrine resistance.
· Human Diseases > Cancers: Specific types > Prostate cancer.(View pathway)
· Organismal Systems > Immune system > Th1 and Th2 cell differentiation.(View pathway)
· Organismal Systems > Immune system > Toll-like receptor signaling pathway.(View pathway)
· Organismal Systems > Immune system > IL-17 signaling pathway.(View pathway)
· Organismal Systems > Immune system > Platelet activation.(View pathway)
· Organismal Systems > Immune system > T cell receptor signaling pathway.(View pathway)
· Organismal Systems > Immune system > Fc epsilon RI signaling pathway.(View pathway)
· Organismal Systems > Immune system > Fc gamma R-mediated phagocytosis.(View pathway)
· Organismal Systems > Endocrine system > Progesterone-mediated oocyte maturation.
· Organismal Systems > Immune system > Natural killer cell mediated cytotoxicity.(View pathway)
· Organismal Systems > Endocrine system > Relaxin signaling pathway.
· Organismal Systems > Endocrine system > Thyroid hormone signaling pathway.(View pathway)
· Organismal Systems > Circulatory system > Adrenergic signaling in cardiomyocytes.(View pathway)
· Organismal Systems > Excretory system > Aldosterone-regulated sodium reabsorption.
· Organismal Systems > Endocrine system > Insulin signaling pathway.(View pathway)
· Organismal Systems > Immune system > Th17 cell differentiation.(View pathway)
· Organismal Systems > Endocrine system > Prolactin signaling pathway.(View pathway)
· Organismal Systems > Nervous system > Long-term potentiation.
· Organismal Systems > Nervous system > Neurotrophin signaling pathway.(View pathway)
· Organismal Systems > Circulatory system > Vascular smooth muscle contraction.(View pathway)
· Organismal Systems > Development > Osteoclast differentiation.(View pathway)
· Organismal Systems > Endocrine system > Oxytocin signaling pathway.
· Organismal Systems > Development > Axon guidance.(View pathway)
· Organismal Systems > Nervous system > Long-term depression.
· Organismal Systems > Nervous system > Glutamatergic synapse.
· Organismal Systems > Nervous system > Cholinergic synapse.
· Organismal Systems > Environmental adaptation > Circadian entrainment.
· Organismal Systems > Immune system > NOD-like receptor signaling pathway.(View pathway)
· Organismal Systems > Endocrine system > Melanogenesis.
· Organismal Systems > Immune system > Chemokine signaling pathway.(View pathway)
· Organismal Systems > Nervous system > Retrograde endocannabinoid signaling.(View pathway)
· Organismal Systems > Nervous system > Serotonergic synapse.
· Organismal Systems > Immune system > B cell receptor signaling pathway.(View pathway)
· Organismal Systems > Endocrine system > Estrogen signaling pathway.(View pathway)
WB Images(2)
IHC Images(6)
IF/ICC Images(1)
Peptide-ELISA
P-peptide: phospho-peptide; N-peptide: non-phospho-peptide.
Reference Citations:
Application: WB Species:Not available; Sample:Not available
Application: WB Species:rat; Sample:rat
Fig. 4. FGFR- ERK signaling pathway is involved in FGF2-induced EAAC1 expression. (A) C6 cells were incubated with FGF2 (10 ng/mL) for different durations. (B, C) Before incubation with FGF2 (10 ng/mL) for 15 min (B) or 24 h (C), cells were pretreated with the FGFR kinase inhibitor SU5402 (SU; 25 lM, 5 min) or the ERK inhibitor U0126 (U0; 10 lM, 1 h). Phosphorylation of FRS2a or ERK1/2 (A and B, respectively), and EAAC1 expression (C) were analyzed by Western blots. Data are shown as mean ± SEM from three independent experiments. * p < 0.05; **p < 0.01 versus the control group. # p < 0.05; ##p < 0.01 versus the FGF2 alone group.
Application: WB Species:rat; Sample:C6 Cells
Fig. 3 OBHS and RAL increase Akt and ERK phosphorylation through GPER1. a Akt and ERK inhibitors attenuated the pro-survival effects of OBHS and RAL against Aβ toxicity. Cells were pretreated with specific inhibitors LY294002 (LY, 20 μM), U0126 (U,10 μM) for one hour and then incubated with OBHS (1 μM) or RAL (1 μM) for 45 min, after Aβ treatment for an additional 24 h. Cell viability was measured by MTT method. b,c C6 cells were preincubated with PI3K/Akt inhibitor LY (b) or ERK inhibitor U (c) for one hour, followed by OBHS (1 μM) or RAL (1 μM) treatment for 15 min. d GPER1 antagonist G15 (10 μM) was added to the media for 24 h, before OBHS (1 μM) or RAL (1 μM) treatment for 15 min of C6 cells. The proteins were analyzed by the western blot method. The data were shown as the mean±SD from three independent experiments.
Application: WB Species:human; Sample:Not available
Fig.2 Protein Expression of NDRD3-Raf-ERK pathway, A2a receptors, Cytochrome C.
Application: WB Species:Not available; Sample:Not available
Application: WB Species:mouse; Sample:Not available
Figure 3. Effects of 11‑O‑acetylcyathatriol on the protein expression levels of iNOS and COX‑2. The RAW 264.7 cells were treated by 1 µg/ml of LPS with indicated concentrations of 11-O‑acetylcyathatriol (12.5, 25, 50 and 100 µM) for 24 h, and the expression levels of (A) iNOS and COX‑2 were detected using western blot analysis. (B) Effects of 11‑O-acetylcyathatriol on the phosphorylation of ERK1/2, JNK and p38 proteins. RAW 264.7 cells were treated with 1 µg/ml LPS with 11‑O‑acetylcyathatriol (12.5, 25, 50 and 100 µM) for 30 min, and the protein expression levels of p‑ERK1/2, p‑JNK and p‑p38 were detected using western blot analysis. (C) Effects of 11‑O-acetylcyathatriol on the protein degradation of IκB-α. RAW 264.7 cells were treated with 1 µg/ml of LPS with 11-O‑acetylcyathatriol (12.5, 25, 50 and 100 µM) for 10 min, and the protein expression of IκB-α was detected using western blot analysis. iNOS, inducible nitric oxide synthase; COX‑2, cyclooxygenase‑2; LPS, lipopolysaccharide; ERK, extracellular signal‑regulated kinase; JNK, c‑Jun N‑terminal kinase; IκB-α, inhibitor of nuclear factor-κB-α; p‑, phosphorylated.
Application: WB Species:mouse; Sample:Not available
Figure 7. Effect of tiliroside on the phosphorylation of mitogen‑activated protein kinase‑ERK/JNK/p38 proteins. (A) RAW 264.7 cells were treated with LPS 1 µg/ml with or without tiliroside (12.5, 25, 50, and 100 µM) for 45 min and the expression of p‑ERK1/2, p‑JNK and p‑p38 was assessed by western blot analysis. Detection of β‑actin was conducted to confirm the equal loading of proteins. Densitometric analysis of p‑ERK1/2 (B) p‑JNK (C) and p‑p38 (D) expression represent the mean±standard deviation of three separate experiments. Data were normalized with respect to β‑actin levels. **P
Application: WB Species:human; Sample:Not available
Figure 4: Induction of miR-370 over-expression reduces EGFR and HIF-1α expression and inhibits the ERK and AKT phosphorylation in XWLC-05 and H157 cells. XWLC-05 and H157 cells were transfected with miR-370 mimics, miR-370 inhibitor or corresponding controls for 24 h. The relative levels of EGFR, HIF-1α, ERK, AKT expression, ERK and AKT phosphorylation were determined by Western blot assays. Data are representative images or expressed as the means ± SEM of each group of cells from three separate experiments. *P<0.05, **P<0.01, ***P<0.001, ****P<0.0001.
Application: WB Species:human; Sample:MCF-7
Figure 5: Effect of miR-29a on the insulin signaling pathways. (A) IGF-1R, CDC42, p85α, p-ERK and ERK mRNA levels were determined by qPCR in ER-positive cells transfected with a miR-29a mimic or miR-29a inhibitor. (B, C) Western blotting analysis was performed to monitor IGF-1R, CDC42, p85α, p-ERK and ERK expression in ER-positive cells transfected with a miR-29a mimic or miR-29a inhibitor. The results showed that ERK, CDC42 and p85α are the target genes of miR-29a; however, miR-29a promotes breast cancer cell growth and proliferation mainly by activating ERK phosphorylation.
Application: WB Species:mouse; Sample:Not available
Figure 4: MiR-377 promotes inflammation and insulin-resistance in mature 3T3-L1 cells. After transfection with 100 nM miR-377 mimics or inhibitor for 24 h, differentiated 3T3-L1 adipocytes were treated with 10 ng/ml TNFα for 24 h and then stimulated with 100 nM insulin for 15 min. Cells were then harvested for real-time PCR and immunoblotting analyses. (A) The effect of miR-377 overexpression on inflammation-related gene expression. *P < 0.05, **P < 0.01 vs. NC 0.1% BSA; ##P < 0.01 vs. NC 10 ng/ml TNFα; ns, not signifcant (n = 3). (B) The effect of miR-377 inhibition on inflammation-related gene expression under conditions of TNFα-induced insulin-resistance. ##P < 0.01 vs. NC 10 ng/ml TNFα(n = 3). (C) The effect of miR-377 overexpression on JNK phosphorylation under conditions of TNFα-induced insulin-resistance. *P < 0.05 vs. NC without insulin; #P < 0.05 vs. NC with insulin (n = 3). (D and E) The effect of miR-377 overexpression on AKT and ERK phosphorylation. *P < 0.05 vs. NC with 0.1% BSA and insulin; #P < 0.05 vs. NC with 10 ng/ml TNFα and insulin (n = 3). (F) The effect of miR-377 inhibition on JNK phosphorylation under conditions of TNFα-induced insulin-resistance. *P < 0.05 vs. NC without insulin; #P < 0.05 vs. NC with insulin (n = 3). (G and H) The effect of miR-377 inhibition on AKT and ERK phosphorylation. *P < 0.05 vs. NC with 0.1% BSA and insulin; #P < 0.05 vs. NC with 10 ng/ml TNFα and insulin (n = 3).
评论提交
Catalog Number :
AF1015-BP
(Blocking peptide available as AF1015-BP)
Price/Size :
￥2000/1mg.
Tips: For phospho antibody, we provide phospho peptide（0.5mg) and non-phospho peptide(0.5mg).
Function :
Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. This mechanism is useful when non-specific binding is an issue, for example, in Western blotting (immunoblot) and immunohistochemistry (IHC). By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific; Specific binding will be absent from the western blot or immunostaining performed with the neutralized antibody.
Format and storage :
Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 10 mg/ml.The purity is >90%,tested by HPLC and MS.Storage Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.
Precautions :
This product is for research use only. Not for use in diagnostic or therapeutic procedures.
P27361/P28482 as Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| A2 | Acetylation | Uniprot | |
| K32 | Ubiquitination | Uniprot | |
| S58 | Phosphorylation | Uniprot | |
| K72 | Ubiquitination | Uniprot | |
| T80 | Phosphorylation | Uniprot | |
| Y130 | Phosphorylation | Uniprot | |
| K155 | Ubiquitination | Uniprot | |
| S159 | Phosphorylation | Uniprot | |
| S170 | Phosphorylation | Uniprot | |
| K181 | Acetylation | Uniprot | |
| K181 | Ubiquitination | Uniprot | |
| T198 | Phosphorylation | Uniprot | |
| T202 | Phosphorylation | Q02750 (MAP2K1) , P36507 (MAP2K2) | Uniprot |
| Y204 | Phosphorylation | P27361 (MAPK3) , O60674 (JAK2) , Q02750 (MAP2K1) , P07949 (RET) , P06239 (LCK) , P36507 (MAP2K2) | Uniprot |
| T207 | Phosphorylation | Q02750 (MAP2K1) , P27361 (MAPK3) | Uniprot |
| Y210 | Phosphorylation | Q02750 (MAP2K1) | Uniprot |
| R211 | Methylation | Uniprot | |
| S219 | Phosphorylation | Uniprot | |
| K220 | Ubiquitination | Uniprot | |
| Y222 | Phosphorylation | Uniprot | |
| T223 | Phosphorylation | Uniprot | |
| S265 | Phosphorylation | Uniprot | |
| K287 | Ubiquitination | Uniprot | |
| K289 | Ubiquitination | Uniprot | |
| K294 | Ubiquitination | Uniprot | |
| K298 | Ubiquitination | Uniprot | |
| K302 | Methylation | Uniprot | |
| K302 | Ubiquitination | Uniprot | |
| R309 | Methylation | Uniprot | |
| K317 | Ubiquitination | Uniprot | |
| K357 | Ubiquitination | Uniprot | |
| K361 | Methylation | Uniprot | |
| K361 | Ubiquitination | Uniprot |
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| A2 | Acetylation | Uniprot | |
| Y25 | Phosphorylation | Uniprot | |
| S29 | Phosphorylation | O00141 (SGK1) | Uniprot |
| Y36 | Phosphorylation | Uniprot | |
| Y43 | Phosphorylation | Uniprot | |
| K55 | Ubiquitination | Uniprot | |
| T63 | Phosphorylation | Uniprot | |
| C65 | S-Nitrosylation | Uniprot | |
| K99 | Ubiquitination | Uniprot | |
| Y113 | Phosphorylation | Uniprot | |
| K138 | Ubiquitination | Uniprot | |
| S142 | Phosphorylation | Uniprot | |
| K151 | Ubiquitination | Uniprot | |
| K164 | Ubiquitination | Uniprot | |
| C166 | S-Nitrosylation | Uniprot | |
| T181 | Phosphorylation | Uniprot | |
| T185 | Phosphorylation | Q02750 (MAP2K1) , P36507 (MAP2K2) | Uniprot |
| Y187 | Phosphorylation | P28482 (MAPK1) , P07949 (RET) , O60674 (JAK2) , Q02750 (MAP2K1) , P36507 (MAP2K2) | Uniprot |
| T190 | Phosphorylation | P28482 (MAPK1) | Uniprot |
| Y193 | Phosphorylation | Uniprot | |
| R194 | Methylation | Uniprot | |
| S202 | Phosphorylation | Uniprot | |
| K203 | Ubiquitination | Uniprot | |
| Y205 | Phosphorylation | Uniprot | |
| T206 | Phosphorylation | Uniprot | |
| S246 | Phosphorylation | P68400 (CSNK2A1) , P28482 (MAPK1) | Uniprot |
| S248 | Phosphorylation | P68400 (CSNK2A1) | Uniprot |
| K259 | Ubiquitination | Uniprot | |
| Y263 | Phosphorylation | Uniprot | |
| K270 | Ubiquitination | Uniprot | |
| K272 | Ubiquitination | Uniprot | |
| S284 | Phosphorylation | Uniprot | |
| K285 | Ubiquitination | Uniprot | |
| K292 | Ubiquitination | Uniprot | |
| T295 | Phosphorylation | Uniprot | |
| K300 | Ubiquitination | Uniprot | |
| K330 | Ubiquitination | Uniprot | |
| K340 | Ubiquitination | Uniprot | |
| K344 | Ubiquitination | Uniprot | |
| S360 | Phosphorylation | Uniprot |
P27361/P28482 as PTM Enzyme
| Substrate | Site | Source |
|---|---|---|
| C9JLW8 (MCRIP1) | S21 | Uniprot |
| C9JLW8 (MCRIP1) | T30 | Uniprot |
| O00213 (APBB1) | S175 | Uniprot |
| O00213 (APBB1) | S287 | Uniprot |
| O00213 (APBB1) | S347 | Uniprot |
| O00213 (APBB1) | T709 | Uniprot |
| O00267 (SUPT5H) | S666 | Uniprot |
| O00429 (DNM1L) | S616 | Uniprot |
| O00562 (PITPNM1) | T794 | Uniprot |
| O00562 (PITPNM1) | T1223 | Uniprot |
| O14613 (CDC42EP2) | S101 | Uniprot |
| O43251 (RBFOX2) | T7 | Uniprot |
| O43294 (TGFB1I1) | S141 | Uniprot |
| O43521 (BCL2L11) | S69 | Uniprot |
| O43524 (FOXO3) | S294 | Uniprot |
| O43524 (FOXO3) | S344 | Uniprot |
| O43524 (FOXO3) | S425 | Uniprot |
| O43623 (SNAI2) | S87 | Uniprot |
| O43623 (SNAI2) | S104 | Uniprot |
| O60331 (PIP5K1C) | S650 | Uniprot |
| O60502 (OGA) | T709 | Uniprot |
| O60504-2 (SORBS3) | S188 | Uniprot |
| O60504 (SORBS3) | S530 | Uniprot |
| O60504 (SORBS3) | T585 | Uniprot |
| O60749 (SNX2) | T104 | Uniprot |
| O75030-9 (MITF) | S73 | Uniprot |
| O75030 (MITF) | S180 | Uniprot |
| O75151 (PHF2) | S655 | Uniprot |
| O75581 (LRP6) | S1490 | Uniprot |
| O75581 (LRP6) | T1572 | Uniprot |
| O75582 (RPS6KA5) | S360 | Uniprot |
| O75582-1 (RPS6KA5) | S376 | Uniprot |
| O75582 (RPS6KA5) | T581 | Uniprot |
| O75582 (RPS6KA5) | T700 | Uniprot |
| O94804 (STK10) | T952 | Uniprot |
| O94811 (TPPP) | T14 | Uniprot |
| O94811 (TPPP) | S18 | Uniprot |
| O94811 (TPPP) | S160 | Uniprot |
| O95785 (WIZ) | S983 | Uniprot |
| O95863 (SNAI1) | S82 | Uniprot |
| O95863 (SNAI1) | S104 | Uniprot |
| O95997 (PTTG1) | S165 | Uniprot |
| P00533 (EGFR) | T693 | Uniprot |
| P01100 (FOS) | T232 | Uniprot |
| P01100 (FOS) | T325 | Uniprot |
| P01100-1 (FOS) | T331 | Uniprot |
| P01100 (FOS) | S374 | Uniprot |
| P01106 (MYC) | T58 | Uniprot |
| P01106 (MYC) | S62 | Uniprot |
| P01106 (MYC) | S71 | Uniprot |
| P02545 (LMNA) | S22 | Uniprot |
| P02686-5 (MBP) | T99 | Uniprot |
| P02686-1 (MBP) | T229 | Uniprot |
| P02686 (MBP) | T232 | Uniprot |
| P03372 (ESR1) | S104 | Uniprot |
| P03372 (ESR1) | S106 | Uniprot |
| P03372 (ESR1) | S118 | Uniprot |
| P04049-1 (RAF1) | S29 | Uniprot |
| P04049-1 (RAF1) | S289 | Uniprot |
| P04049 (RAF1) | S296 | Uniprot |
| P04049-1 (RAF1) | S301 | Uniprot |
| P04049 (RAF1) | S642 | Uniprot |
| P04150-2 (NR3C1) | S226 | Uniprot |
| P04637-1 (TP53) | S15 | Uniprot |
| P04637 (TP53) | T55 | Uniprot |
| P05023 (ATP1A1) | S16 | Uniprot |
| P05198 (EIF2S1) | S52 | Uniprot |
| P05787-1 (KRT8) | S74 | Uniprot |
| P05787 (KRT8) | T431 | Uniprot |
| P06239 (LCK) | S42 | Uniprot |
| P06239 (LCK) | S59 | Uniprot |
| P06401 (PGR) | S294 | Uniprot |
| P07101-3 (TH) | S31 | Uniprot |
| P07101-2 (TH) | S58 | Uniprot |
| P07101 (TH) | S62 | Uniprot |
| P07196 (NEFL) | T21 | Uniprot |
| P08047 (SP1) | S59 | Uniprot |
| P08047-1 (SP1) | T453 | Uniprot |
| P08047 (SP1) | T739 | Uniprot |
| P09874 (PARP1) | S372 | Uniprot |
| P09874 (PARP1) | T373 | Uniprot |
| P09917 (ALOX5) | S664 | Uniprot |
| P10070 (GLI2) | T903 | Uniprot |
| P10242-1 (MYB) | S532 | Uniprot |
| P10275-1 (AR) | S516 | Uniprot |
| P10415 (BCL2) | T56 | Uniprot |
| P10415 (BCL2) | S70 | Uniprot |
| P10415 (BCL2) | T74 | Uniprot |
| P10415-1 (BCL2) | S87 | Uniprot |
| P10636-8 (MAPT) | S46 | Uniprot |
| P10636-8 (MAPT) | T50 | Uniprot |
| P10636-6 (MAPT) | T117 | Uniprot |
| P10636-2 (MAPT) | T123 | Uniprot |
| P10636-2 (MAPT) | S144 | Uniprot |
| P10636-8 (MAPT) | T153 | Uniprot |
| P10636-8 (MAPT) | T175 | Uniprot |
| P10636-8 (MAPT) | T181 | Uniprot |
| P10636-8 (MAPT) | S199 | Uniprot |
| P10636-8 (MAPT) | S202 | Uniprot |
| P10636-8 (MAPT) | T205 | Uniprot |
| P10636-8 (MAPT) | T212 | Uniprot |
| P10636-8 (MAPT) | T217 | Uniprot |
| P10636-8 (MAPT) | T231 | Uniprot |
| P10636-8 (MAPT) | S235 | Uniprot |
| P10636-8 (MAPT) | S396 | Uniprot |
| P10636-8 (MAPT) | S404 | Uniprot |
| P10636-8 (MAPT) | S422 | Uniprot |
| P10636 (MAPT) | S519 | Uniprot |
| P10636 (MAPT) | T522 | Uniprot |
| P10636 (MAPT) | S721 | Uniprot |
| P10646 (TFPI) | S202 | Uniprot |
| P10828 (THRB) | S142 | Uniprot |
| P11308 (ERG) | S222 | Uniprot |
| P11308 (ERG) | S283 | Uniprot |
| P11362 (FGFR1) | S777 | Uniprot |
| P11388 (TOP2A) | S1213 | Uniprot |
| P11388 (TOP2A) | S1247 | Uniprot |
| P11388 (TOP2A) | S1354 | Uniprot |
| P11388 (TOP2A) | S1361 | Uniprot |
| P11388 (TOP2A) | S1393 | Uniprot |
| P12036 (NEFH) | S518 | Uniprot |
| P12036 (NEFH) | S526 | Uniprot |
| P12036 (NEFH) | S532 | Uniprot |
| P12270 (TPR) | T2116 | Uniprot |
| P12270 (TPR) | T2137 | Uniprot |
| P12270 (TPR) | S2155 | Uniprot |
| P12270 (TPR) | T2214 | Uniprot |
| P12980 (LYL1) | S36 | Uniprot |
| P14543 (NID1) | S333 | Uniprot |
| P14598 (NCF1) | S345 | Uniprot |
| P14598 (NCF1) | S348 | Uniprot |
| P14618 (PKM) | S37 | Uniprot |
| P14635 (CCNB1) | S126 | Uniprot |
| P14635 (CCNB1) | S128 | Uniprot |
| P14784 (IL2RB) | T476 | Uniprot |
| P14921 (ETS1) | T38 | Uniprot |
| P15036 (ETS2) | T72 | Uniprot |
| P15056 (BRAF) | S151 | Uniprot |
| P15056 (BRAF) | T401 | Uniprot |
| P15056 (BRAF) | S750 | Uniprot |
| P15056 (BRAF) | T753 | Uniprot |
| P15336 (ATF2) | T69 | Uniprot |
| P15336 (ATF2) | T71 | Uniprot |
| P15336 (ATF2) | S90 | Uniprot |
| P15391-1 (CD19) | Y348 | Uniprot |
| P15391-1 (CD19) | Y378 | Uniprot |
| P15391-1 (CD19) | Y409 | Uniprot |
| P15391-1 (CD19) | Y439 | Uniprot |
| P15923-2 (TCF3) | S352 | Uniprot |
| P15923-2 (TCF3) | T355 | Uniprot |
| P15923-2 (TCF3) | S359 | Uniprot |
| P16220 (CREB1) | S133 | Uniprot |
| P16949 (STMN1) | S25 | Uniprot |
| P16949 (STMN1) | S38 | Uniprot |
| P17252 (PRKCA) | T638 | Uniprot |
| P17302 (GJA1) | S255 | Uniprot |
| P17302 (GJA1) | S279 | Uniprot |
| P17302 (GJA1) | S282 | Uniprot |
| P17480 (UBTF) | T117 | Uniprot |
| P17480 (UBTF) | T201 | Uniprot |
| P17535 (JUND) | S100 | Uniprot |
| P17655 (CAPN2) | S50 | Uniprot |
| P17676 (CEBPB) | T235 | Uniprot |
| P17861 (XBP1) | S68 | Uniprot |
| P17861 (XBP1) | S181 | Uniprot |
| P19419 (ELK1) | S383 | Uniprot |
| P19419 (ELK1) | S389 | Uniprot |
| P19438-1 (TNFRSF1A) | S274 | Uniprot |
| P19438-1 (TNFRSF1A) | T280 | Uniprot |
| P19484 (TFEB) | S142 | Uniprot |
| P19525 (EIF2AK2) | T451 | Uniprot |
| P19634 (SLC9A1) | S693 | Uniprot |
| P19634-1 (SLC9A1) | S766 | Uniprot |
| P19634 (SLC9A1) | S770 | Uniprot |
| P19634-1 (SLC9A1) | T779 | Uniprot |
| P19634-1 (SLC9A1) | S785 | Uniprot |
| P19793 (RXRA) | S260 | Uniprot |
| P19878 (NCF2) | T233 | Uniprot |
| P22736-1 (NR4A1) | T143 | Uniprot |
| P22736 (NR4A1) | S431 | Uniprot |
| P23396 (RPS3) | T42 | Uniprot |
| P23396 (RPS3) | T221 | Uniprot |
| P23443 (RPS6KB1) | S434 | Uniprot |
| P23443 (RPS6KB1) | T444 | Uniprot |
| P23443 (RPS6KB1) | S447 | Uniprot |
| P24046-1 (GABRR1) | T394 | Uniprot |
| P24046-1 (GABRR1) | S435 | Uniprot |
| P24046-1 (GABRR1) | S440 | Uniprot |
| P24928 (POLR2A) | S1619 | Uniprot |
| P24928 (POLR2A) | S1626 | Uniprot |
| P24928 (POLR2A) | S1647 | Uniprot |
| P24928 (POLR2A) | S1654 | Uniprot |
| P24928 (POLR2A) | S1668 | Uniprot |
| P24928 (POLR2A) | S1675 | Uniprot |
| P24928 (POLR2A) | S1696 | Uniprot |
| P24928 (POLR2A) | S1717 | Uniprot |
| P24928 (POLR2A) | S1724 | Uniprot |
| P24928 (POLR2A) | S1738 | Uniprot |
| P24928 (POLR2A) | S1766 | Uniprot |
| P24928 (POLR2A) | S1787 | Uniprot |
| P24928 (POLR2A) | S1864 | Uniprot |
| P24928 (POLR2A) | S1871 | Uniprot |
| P24928 (POLR2A) | S1878 | Uniprot |
| P24928 (POLR2A) | S1892 | Uniprot |
| P24928 (POLR2A) | S1899 | Uniprot |
| P24928 (POLR2A) | S1913 | Uniprot |
| P24928 (POLR2A) | S1920 | Uniprot |
| P24928 (POLR2A) | S1927 | Uniprot |
| P24928 (POLR2A) | S1934 | Uniprot |
| P24928 (POLR2A) | S1944 | Uniprot |
| P24928 (POLR2A) | S1951 | Uniprot |
| P24941 (CDK2) | T160 | Uniprot |
| P27708 (CAD) | T456 | Uniprot |
| P28482-1 (MAPK1) | S41 | Uniprot |
| P28482-1 (MAPK1) | T185 | Uniprot |
| P28482 (MAPK1) | Y187 | Uniprot |
| P28482 (MAPK1) | T190 | Uniprot |
| P28482 (MAPK1) | S246 | Uniprot |
| P28562 (DUSP1) | S296 | Uniprot |
| P28562 (DUSP1) | S323 | Uniprot |
| P28562 (DUSP1) | S359 | Uniprot |
| P28562 (DUSP1) | S364 | Uniprot |
| P29590-4 (PML) | T28 | Uniprot |
| P29590 (PML) | S36 | Uniprot |
| P29590 (PML) | S38 | Uniprot |
| P29590 (PML) | S40 | Uniprot |
| P29590 (PML) | S527 | Uniprot |
| P29590-4 (PML) | S530 | Uniprot |
| P30041 (PRDX6) | T177 | Uniprot |
| P30307 (CDC25C) | S216 | Uniprot |
| P31645 (SLC6A4) | T616 | Uniprot |
| P31749 (AKT1) | S473 | Uniprot |
| P31943 (HNRNPH1) | S104 | Uniprot |
| P32004 (L1CAM) | S1204 | Uniprot |
| P32004 (L1CAM) | S1248 | Uniprot |
| P32121 (ARRB2) | S14 | Uniprot |
| P32121 (ARRB2) | T276 | Uniprot |
| P33076 (CIITA) | S280 | Uniprot |
| P33076 (CIITA) | S288 | Uniprot |
| P33981 (TTK) | S821 | Uniprot |
| P35236 (PTPN7) | T66 | Uniprot |
| P35236 (PTPN7) | S93 | Uniprot |
| P35236-2 (PTPN7) | T105 | Uniprot |
| P35236-2 (PTPN7) | S132 | Uniprot |
| P35398-4 (RORA) | T128 | Uniprot |
| P35398 (RORA) | T183 | Uniprot |
| P35568 (IRS1) | S312 | Uniprot |
| P35568 (IRS1) | S616 | Uniprot |
| P35568 (IRS1) | S636 | Uniprot |
| P35568 (IRS1) | S639 | Uniprot |
| P35658 (NUP214) | S1710 | Uniprot |
| P35658 (NUP214) | S1809 | Uniprot |
| P36956-3 (SREBF1) | T81 | Uniprot |
| P36956-3 (SREBF1) | S93 | Uniprot |
| P36956 (SREBF1) | S117 | Uniprot |
| P36956-4 (SREBF1) | S147 | Uniprot |
| P37231-2 (PPARG) | S84 | Uniprot |
| P37231 (PPARG) | S112 | Uniprot |
| P38936 (CDKN1A) | T57 | Uniprot |
| P38936 (CDKN1A) | S130 | Uniprot |
| P40763-2 (STAT3) | S726 | Uniprot |
| P40763 (STAT3) | S727 | Uniprot |
| P41162 (ETV3) | S139 | Uniprot |
| P41182 (BCL6) | S333 | Uniprot |
| P41182 (BCL6) | S343 | Uniprot |
| P42224 (STAT1) | S727 | Uniprot |
| P42229 (STAT5A) | S780 | Uniprot |
| P42702-1 (LIFR) | S1044 | Uniprot |
| P43354 (NR4A2) | S126 | Uniprot |
| P43354 (NR4A2) | T132 | Uniprot |
| P43694 (GATA4) | S105 | Uniprot |
| P46527 (CDKN1B) | S10 | Uniprot |
| P46527 (CDKN1B) | S178 | Uniprot |
| P46527 (CDKN1B) | T187 | Uniprot |
| P46695 (IER3) | T18 | Uniprot |
| P46821 (MAP1B) | S1785 | Uniprot |
| P47712 (PLA2G4A) | S505 | Uniprot |
| P48634 (PRRC2A) | T610 | Uniprot |
| P48634 (PRRC2A) | S1004 | Uniprot |
| P48634 (PRRC2A) | S1219 | Uniprot |
| P49023-2 (PXN) | S83 | Uniprot |
| P49023-2 (PXN) | S126 | Uniprot |
| P49023-2 (PXN) | S130 | Uniprot |
| P49137 (MAPKAPK2) | S9 | Uniprot |
| P49137 (MAPKAPK2) | T25 | Uniprot |
| P49137 (MAPKAPK2) | T222 | Uniprot |
| P49137 (MAPKAPK2) | S272 | Uniprot |
| P49137 (MAPKAPK2) | T334 | Uniprot |
| P49137 (MAPKAPK2) | T338 | Uniprot |
| P49407-2 (ARRB1) | S404 | Uniprot |
| P49407 (ARRB1) | S412 | Uniprot |
| P49418 (AMPH) | S293 | Uniprot |
| P49418 (AMPH) | S295 | Uniprot |
| P49585 (PCYT1A) | S315 | Uniprot |
| P49715 (CEBPA) | S21 | Uniprot |
| P49790 (NUP153) | S257 | Uniprot |
| P49790 (NUP153) | S320 | Uniprot |
| P49790 (NUP153) | S334 | Uniprot |
| P49790 (NUP153) | S338 | Uniprot |
| P49790 (NUP153) | T369 | Uniprot |
| P49790 (NUP153) | T388 | Uniprot |
| P49790 (NUP153) | T413 | Uniprot |
| P49790 (NUP153) | S516 | Uniprot |
| P49790 (NUP153) | S522 | Uniprot |
| P49790 (NUP153) | S529 | Uniprot |
| P49790 (NUP153) | S614 | Uniprot |
| P49795 (RGS19) | S151 | Uniprot |
| P49815-1 (TSC2) | S540 | Uniprot |
| P49815-1 (TSC2) | S664 | Uniprot |
| P49841 (GSK3B) | T43 | Uniprot |
| P50548-1 (ERF) | S161 | Uniprot |
| P50548-1 (ERF) | S246 | Uniprot |
| P50548 (ERF) | S251 | Uniprot |
| P50548 (ERF) | T526 | Uniprot |
| P50616 (TOB1) | S152 | Uniprot |
| P50616 (TOB1) | S154 | Uniprot |
| P50616 (TOB1) | S164 | Uniprot |
| P51168 (SCNN1B) | T615 | Uniprot |
| P51170 (SCNN1G) | T622 | Uniprot |
| P51812 (RPS6KA3) | S386 | Uniprot |
| P51812 (RPS6KA3) | Y488 | Uniprot |
| P51812 (RPS6KA3) | Y529 | Uniprot |
| P52945 (PDX1) | S61 | Uniprot |
| P52945 (PDX1) | S66 | Uniprot |
| P53355-1 (DAPK1) | S734 | Uniprot |
| P53805 (RCAN1) | S167 | Uniprot |
| P55211 (CASP9) | T125 | Uniprot |
| P61978 (HNRNPK) | S284 | Uniprot |
| P68400 (CSNK2A1) | T360 | Uniprot |
| P68400 (CSNK2A1) | S362 | Uniprot |
| P68431 (HIST1H3J) | S29 | Uniprot |
| P78347-2 (GTF2I) | S627 | Uniprot |
| P78347-2 (GTF2I) | S633 | Uniprot |
| P78347 (GTF2I) | S668 | Uniprot |
| P78347 (GTF2I) | S674 | Uniprot |
| P78352 (DLG4) | T287 | Uniprot |
| P78536 (ADAM17) | T735 | Uniprot |
| P78559 (MAP1A) | T2042 | Uniprot |
| P78559 (MAP1A) | S2419 | Uniprot |
| P84022 (SMAD3) | T179 | Uniprot |
| P84022 (SMAD3) | S204 | Uniprot |
| P84022 (SMAD3) | S208 | Uniprot |
| P84022-1 (SMAD3) | S213 | Uniprot |
| P84243 (H3F3B) | S29 | Uniprot |
| Q00587 (CDC42EP1) | S113 | Uniprot |
| Q00587 (CDC42EP1) | S195 | Uniprot |
| Q00613 (HSF1) | S307 | Uniprot |
| Q00975 (CACNA1B) | S411 | Uniprot |
| Q00975 (CACNA1B) | S446 | Uniprot |
| Q01196 (RUNX1) | S249 | Uniprot |
| Q01196 (RUNX1) | S266 | Uniprot |
| Q01196 (RUNX1) | T273 | Uniprot |
| Q01196-8 (RUNX1) | S276 | Uniprot |
| Q01196-8 (RUNX1) | S293 | Uniprot |
| Q01196-8 (RUNX1) | T300 | Uniprot |
| Q01196-8 (RUNX1) | S303 | Uniprot |
| Q01196-8 (RUNX1) | S462 | Uniprot |
| Q01844 (EWSR1) | T79 | Uniprot |
| Q01860 (POU5F1) | S111 | Uniprot |
| Q01860 (POU5F1) | T118 | Uniprot |
| Q01860 (POU5F1) | S355 | Uniprot |
| Q01959 (SLC6A3) | S53 | Uniprot |
| Q02224 (CENPE) | S2605 | Uniprot |
| Q02224 (CENPE) | S2608 | Uniprot |
| Q02224 (CENPE) | S2639 | Uniprot |
| Q02224 (CENPE) | S2654 | Uniprot |
| Q02447 (SP3) | S73 | Uniprot |
| Q02641 (CACNB1) | S161 | Uniprot |
| Q02641 (CACNB1) | S348 | Uniprot |
| Q02750 (MAP2K1) | T286 | Uniprot |
| Q02750 (MAP2K1) | T292 | Uniprot |
| Q02750 (MAP2K1) | T386 | Uniprot |
| Q02952 (AKAP12) | S286 | Uniprot |
| Q04206 (RELA) | T435 | Uniprot |
| Q04637-8 (EIF4G1) | S1232 | Uniprot |
| Q05209 (PTPN12) | S571 | Uniprot |
| Q05397 (PTK2) | S910 | Uniprot |
| Q05469-1 (LIPE) | T891 | Uniprot |
| Q05682-4 (CALD1) | S534 | Uniprot |
| Q05682 (CALD1) | S759 | Uniprot |
| Q05682 (CALD1) | S789 | Uniprot |
| Q07343-2 (PDE4B) | S487 | Uniprot |
| Q07343 (PDE4B) | S659 | Uniprot |
| Q07666 (KHDRBS1) | S58 | Uniprot |
| Q07666 (KHDRBS1) | T72 | Uniprot |
| Q07666-1 (KHDRBS1) | T84 | Uniprot |
| Q07812 (BAX) | T167 | Uniprot |
| Q07820 (MCL1) | T163 | Uniprot |
| Q07866 (KLC1) | S460 | Uniprot |
| Q07869-1 (PPARA) | S12 | Uniprot |
| Q07869 (PPARA) | S21 | Uniprot |
| Q07889 (SOS1) | S1132 | Uniprot |
| Q07889-1 (SOS1) | S1167 | Uniprot |
| Q07889-1 (SOS1) | S1178 | Uniprot |
| Q07889 (SOS1) | S1193 | Uniprot |
| Q07889-1 (SOS1) | S1197 | Uniprot |
| Q08493-2 (PDE4C) | S535 | Uniprot |
| Q08493 (PDE4C) | S641 | Uniprot |
| Q08499-5 (PDE4D) | S413 | Uniprot |
| Q08499-4 (PDE4D) | S490 | Uniprot |
| Q08499-2 (PDE4D) | S579 | Uniprot |
| Q08499 (PDE4D) | S715 | Uniprot |
| Q09472 (EP300) | T317 | Uniprot |
| Q09472 (EP300) | T938 | Uniprot |
| Q09472 (EP300) | S1038 | Uniprot |
| Q09472 (EP300) | T1960 | Uniprot |
| Q09472 (EP300) | S2039 | Uniprot |
| Q09472 (EP300) | S2279 | Uniprot |
| Q09472 (EP300) | S2315 | Uniprot |
| Q09472 (EP300) | S2366 | Uniprot |
| Q09666 (AHNAK) | S216 | Uniprot |
| Q09666 (AHNAK) | T694 | Uniprot |
| Q09666 (AHNAK) | S5099 | Uniprot |
| Q09666 (AHNAK) | S5110 | Uniprot |
| Q09666 (AHNAK) | T5794 | Uniprot |
| Q12772 (SREBF2) | S432 | Uniprot |
| Q12772 (SREBF2) | S455 | Uniprot |
| Q12778 (FOXO1) | S246 | Uniprot |
| Q12778 (FOXO1) | S413 | Uniprot |
| Q12778 (FOXO1) | S418 | Uniprot |
| Q12778 (FOXO1) | S429 | Uniprot |
| Q12778 (FOXO1) | S470 | Uniprot |
| Q12778 (FOXO1) | T478 | Uniprot |
| Q12778 (FOXO1) | T560 | Uniprot |
| Q12800 (TFCP2) | S291 | Uniprot |
| Q12800 (TFCP2) | S309 | Uniprot |
| Q13153 (PAK1) | T212 | Uniprot |
| Q13164 (MAPK7) | T733 | Uniprot |
| Q13285 (NR5A1) | S203 | Uniprot |
| Q13322-3 (GRB10) | S92 | Uniprot |
| Q13322 (GRB10) | S150 | Uniprot |
| Q13322-3 (GRB10) | S360 | Uniprot |
| Q13322-2 (GRB10) | S372 | Uniprot |
| Q13322 (GRB10) | S418 | Uniprot |
| Q13322-2 (GRB10) | S430 | Uniprot |
| Q13322 (GRB10) | S476 | Uniprot |
| Q13362 (PPP2R5C) | S337 | Uniprot |
| Q13409 (DYNC1I2) | S87 | Uniprot |
| Q13459 (MYO9B) | T1346 | Uniprot |
| Q13480-1 (GAB1) | T312 | Uniprot |
| Q13480-2 (GAB1) | S381 | Uniprot |
| Q13480 (GAB1) | S454 | Uniprot |
| Q13480 (GAB1) | T476 | Uniprot |
| Q13480-1 (GAB1) | S551 | Uniprot |
| Q13480-1 (GAB1) | S567 | Uniprot |
| Q13480-2 (GAB1) | S581 | Uniprot |
| Q13480 (GAB1) | S582 | Uniprot |
| Q13480-2 (GAB1) | S597 | Uniprot |
| Q13485 (SMAD4) | T277 | Uniprot |
| Q13541 (EIF4EBP1) | T37 | Uniprot |
| Q13541 (EIF4EBP1) | T45 | Uniprot |
| Q13541 (EIF4EBP1) | T46 | Uniprot |
| Q13541 (EIF4EBP1) | S65 | Uniprot |
| Q13541 (EIF4EBP1) | T70 | Uniprot |
| Q13541 (EIF4EBP1) | S83 | Uniprot |
| Q13562 (NEUROD1) | S162 | Uniprot |
| Q13562 (NEUROD1) | S259 | Uniprot |
| Q13562 (NEUROD1) | S266 | Uniprot |
| Q13562 (NEUROD1) | S274 | Uniprot |
| Q13586 (STIM1) | S575 | Uniprot |
| Q13586 (STIM1) | S608 | Uniprot |
| Q13586 (STIM1) | S621 | Uniprot |
| Q13614 (MTMR2) | S58 | Uniprot |
| Q13625 (TP53BP2) | T586 | Uniprot |
| Q13625 (TP53BP2) | S827 | Uniprot |
| Q14005 (IL16) | S845 | Uniprot |
| Q14151 (SAFB2) | S343 | Uniprot |
| Q14157-1 (UBAP2L) | T844 | Uniprot |
| Q14185 (DOCK1) | T1772 | Uniprot |
| Q14247 (CTTN) | S405 | Uniprot |
| Q14247 (CTTN) | S418 | Uniprot |
| Q14643 (ITPR1) | S436 | Uniprot |
| Q14643 (ITPR1) | S1774 | Uniprot |
| Q14654 (KCNJ11) | T341 | Uniprot |
| Q14654 (KCNJ11) | S385 | Uniprot |
| Q14674 (ESPL1) | S1126 | Uniprot |
| Q14686 (NCOA6) | S884 | Uniprot |
| Q14790 (CASP8) | S387 | Uniprot |
| Q14934 (NFATC4) | S676 | Uniprot |
| Q15366 (PCBP2) | S173 | Uniprot |
| Q15366 (PCBP2) | S189 | Uniprot |
| Q15366 (PCBP2) | T213 | Uniprot |
| Q15366 (PCBP2) | S272 | Uniprot |
| Q15398 (DLGAP5) | T329 | Uniprot |
| Q15418-1 (RPS6KA1) | T359 | Uniprot |
| Q15418-1 (RPS6KA1) | S363 | Uniprot |
| Q15418-2 (RPS6KA1) | T368 | Uniprot |
| Q15418-2 (RPS6KA1) | S372 | Uniprot |
| Q15418 (RPS6KA1) | T573 | Uniprot |
| Q15596 (NCOA2) | S736 | Uniprot |
| Q15648 (MED1) | T1032 | Uniprot |
| Q15648 (MED1) | T1457 | Uniprot |
| Q15672 (TWIST1) | S6 | Uniprot |
| Q15672 (TWIST1) | S68 | Uniprot |
| Q15700 (DLG2) | S323 | Uniprot |
| Q15746 (MYLK) | S1779 | Uniprot |
| Q15788-3 (NCOA1) | S395 | Uniprot |
| Q15788-2 (NCOA1) | T1179 | Uniprot |
| Q15788 (NCOA1) | S1185 | Uniprot |
| Q15796 (SMAD2) | T220 | Uniprot |
| Q15796 (SMAD2) | S245 | Uniprot |
| Q15796 (SMAD2) | S250 | Uniprot |
| Q15796 (SMAD2) | S255 | Uniprot |
| Q15797 (SMAD1) | S187 | Uniprot |
| Q15797 (SMAD1) | S195 | Uniprot |
| Q15797-1 (SMAD1) | S206 | Uniprot |
| Q15797 (SMAD1) | S214 | Uniprot |
| Q15831 (STK11) | S428 | Uniprot |
| Q16526 (CRY1) | S247 | Uniprot |
| Q16665 (HIF1A) | S641 | Uniprot |
| Q16665 (HIF1A) | S643 | Uniprot |
| Q16690 (DUSP5) | T321 | Uniprot |
| Q16690 (DUSP5) | S346 | Uniprot |
| Q16690 (DUSP5) | S376 | Uniprot |
| Q16828 (DUSP6) | S159 | Uniprot |
| Q16828 (DUSP6) | S197 | Uniprot |
| Q49AN0 (CRY2) | S266 | Uniprot |
| Q53EZ4 (CEP55) | S425 | Uniprot |
| Q53EZ4 (CEP55) | S428 | Uniprot |
| Q5SW79 (CEP170) | T565 | Uniprot |
| Q5VZ89 (DENND4C) | S989 | Uniprot |
| Q6P0Q8 (MAST2) | S1337 | Uniprot |
| Q6P996 (PDXDC1) | T691 | Uniprot |
| Q6PKG0 (LARP1) | T303 | Uniprot |
| Q6PKG0 (LARP1) | S774 | Uniprot |
| Q6Y7W6 (GIGYF2) | S30 | Uniprot |
| Q6ZS17 (RIPOR1) | S351 | Uniprot |
| Q70E73 (RAPH1) | S610 | Uniprot |
| Q7L5N1 (COPS6) | S148 | Uniprot |
| Q7LDG7 (RASGRP2) | S394 | Uniprot |
| Q7Z5J4 (RAI1) | T1068 | Uniprot |
| Q86UC2 (RSPH3) | T286 | Uniprot |
| Q86UR1 (NOXA1) | S239 | Uniprot |
| Q86UR1 (NOXA1) | S282 | Uniprot |
| Q86UU1 (PHLDB1) | S443 | Uniprot |
| Q86UU1 (PHLDB1) | S461 | Uniprot |
| Q86WB0 (ZC3HC1) | S354 | Uniprot |
| Q86WB0 (ZC3HC1) | S359 | Uniprot |
| Q8IUW5 (RELL1) | T261 | Uniprot |
| Q8IUX7 (AEBP1) | T621 | Uniprot |
| Q8IUX7 (AEBP1) | T1012 | Uniprot |
| Q8IVF2 (AHNAK2) | T510 | Uniprot |
| Q8IVT5-4 (KSR1) | T137 | Uniprot |
| Q8IVT5-4 (KSR1) | T151 | Uniprot |
| Q8IVT5-4 (KSR1) | S320 | Uniprot |
| Q8IW41 (MAPKAPK5) | T182 | Uniprot |
| Q8IX03 (WWC1) | S542 | Uniprot |
| Q8IX03 (WWC1) | S548 | Uniprot |
| Q8IYB8 (SUPV3L1) | S725 | Uniprot |
| Q8IZP0 (ABI1) | S183 | Uniprot |
| Q8IZP0 (ABI1) | S216 | Uniprot |
| Q8IZP0 (ABI1) | S222 | Uniprot |
| Q8IZP0 (ABI1) | S225 | Uniprot |
| Q8IZP0 (ABI1) | T265 | Uniprot |
| Q8IZP0 (ABI1) | S267 | Uniprot |
| Q8IZP0 (ABI1) | S392 | Uniprot |
| Q8IZP0 (ABI1) | T394 | Uniprot |
| Q8IZP0 (ABI1) | S410 | Uniprot |
| Q8IZQ8 (MYOCD) | S815 | Uniprot |
| Q8IZQ8 (MYOCD) | S862 | Uniprot |
| Q8IZQ8 (MYOCD) | S869 | Uniprot |
| Q8IZQ8 (MYOCD) | T896 | Uniprot |
| Q8N122 (RPTOR) | S8 | Uniprot |
| Q8N122 (RPTOR) | S696 | Uniprot |
| Q8N122 (RPTOR) | S863 | Uniprot |
| Q8N1G1 (REXO1) | T269 | Uniprot |
| Q8N9N5 (BANP) | T337 | Uniprot |
| Q8N9N5 (BANP) | T352 | Uniprot |
| Q8NEL9 (DDHD1) | S727 | Uniprot |
| Q8NHW3 (MAFA) | S14 | Uniprot |
| Q8NHW3 (MAFA) | S65 | Uniprot |
| Q8TDM6 (DLG5) | T1279 | Uniprot |
| Q8TER0 (SNED1) | T1239 | Uniprot |
| Q8WX93 (PALLD) | S688 | Uniprot |
| Q8WX93 (PALLD) | S808 | Uniprot |
| Q92731 (ESR2) | S105 | Uniprot |
| Q92793 (CREBBP) | S93 | Uniprot |
| Q92908 (GATA6) | S266 | Uniprot |
| Q92934 (BAD) | S75 | Uniprot |
| Q92974 (ARHGEF2) | T679 | Uniprot |
| Q93062 (RBPMS) | T118 | Uniprot |
| Q969H0 (FBXW7) | T205 | Uniprot |
| Q969V6 (MRTFA) | S454 | Uniprot |
| Q96BY7 (ATG2B) | T398 | Uniprot |
| Q96EP5 (DAZAP1) | T269 | Uniprot |
| Q96EP5 (DAZAP1) | T315 | Uniprot |
| Q96FF9 (CDCA5) | S79 | Uniprot |
| Q96FF9 (CDCA5) | S209 | Uniprot |
| Q96I25 (RBM17) | T71 | Uniprot |
| Q96I25 (RBM17) | S222 | Uniprot |
| Q96LC9 (BMF) | S74 | Uniprot |
| Q96LC9 (BMF) | S77 | Uniprot |
| Q96LL9 (DNAJC30) | S137 | Uniprot |
| Q96PE2 (ARHGEF17) | T702 | Uniprot |
| Q96PH1-4 (NOX5) | S498 | Uniprot |
| Q96PH1 (NOX5) | S544 | Uniprot |
| Q96Q27 (ASB2) | S323 | Uniprot |
| Q96RK0 (CIC) | S1389 | Uniprot |
| Q96RK0 (CIC) | S1409 | Uniprot |
| Q96RS0 (TGS1) | S298 | Uniprot |
| Q96SB3 (PPP1R9B) | S15 | Uniprot |
| Q9BQG0 (MYBBP1A) | S1267 | Uniprot |
| Q9BQQ3 (GORASP1) | S274 | Uniprot |
| Q9BUB5 (MKNK1) | T255 | Uniprot |
| Q9BWW4 (SSBP3) | T360 | Uniprot |
| Q9BY84-1 (DUSP16) | S446 | Uniprot |
| Q9BZI1 (IRX2) | S46 | Uniprot |
| Q9BZI1 (IRX2) | S64 | Uniprot |
| Q9C0C2 (TNKS1BP1) | T131 | Uniprot |
| Q9C0C2 (TNKS1BP1) | T1032 | Uniprot |
| Q9C0D5 (TANC1) | S1564 | Uniprot |
| Q9GZM8 (NDEL1) | T219 | Uniprot |
| Q9GZM8 (NDEL1) | T245 | Uniprot |
| Q9H0D6 (XRN2) | T439 | Uniprot |
| Q9H8Y8 (GORASP2) | T222 | Uniprot |
| Q9H8Y8 (GORASP2) | T225 | Uniprot |
| Q9H9S0 (NANOG) | S52 | Uniprot |
| Q9H9S0 (NANOG) | S71 | Uniprot |
| Q9H9S0 (NANOG) | T78 | Uniprot |
| Q9HBH9 (MKNK2) | S43 | Uniprot |
| Q9HBH9 (MKNK2) | S74 | Uniprot |
| Q9HBH9 (MKNK2) | S220 | Uniprot |
| Q9HBH9 (MKNK2) | T379 | Uniprot |
| Q9HBH9 (MKNK2) | S440 | Uniprot |
| Q9HBH9 (MKNK2) | S452 | Uniprot |
| Q9NQ66 (PLCB1) | S982 | Uniprot |
| Q9NQC3 (RTN4) | T172 | Uniprot |
| Q9NRA0 (SPHK2) | S387 | Uniprot |
| Q9NRA0 (SPHK2) | T614 | Uniprot |
| Q9NRA8 (EIF4ENIF1) | S115 | Uniprot |
| Q9NRF2 (SH2B1) | S96 | Uniprot |
| Q9NSI2 (FAM207A) | S39 | Uniprot |
| Q9NUY8 (TBC1D23) | T514 | Uniprot |
| Q9NXR1 (NDE1) | T215 | Uniprot |
| Q9NXR1 (NDE1) | S239 | Uniprot |
| Q9NYA1 (SPHK1) | S225 | Uniprot |
| Q9NYZ3 (GTSE1) | S461 | Uniprot |
| Q9NZ72 (STMN3) | S68 | Uniprot |
| Q9NZV8 (KCND2) | T602 | Uniprot |
| Q9NZV8 (KCND2) | T607 | Uniprot |
| Q9NZV8 (KCND2) | S616 | Uniprot |
| Q9P0K7 (RAI14) | T249 | Uniprot |
| Q9UBN7 (HDAC6) | T1031 | Uniprot |
| Q9UHB6 (LIMA1) | S362 | Uniprot |
| Q9UHB6 (LIMA1) | S604 | Uniprot |
| Q9UKX7 (NUP50) | S221 | Uniprot |
| Q9UKX7 (NUP50) | S315 | Uniprot |
| Q9ULC4 (MCTS1) | T81 | Uniprot |
| Q9ULW0 (TPX2) | T369 | Uniprot |
| Q9UNA1 (ARHGAP26) | S685 | Uniprot |
| Q9UPT5 (EXOC7) | S250 | Uniprot |
| Q9UQC2 (GAB2) | S623 | Uniprot |
| Q9Y463 (DYRK1B) | S421 | Uniprot |
| Q9Y4F5 (CEP170B) | S969 | Uniprot |
| Q9Y4H2 (IRS2) | T657 | Uniprot |
| Q9Y4K1 (CRYBG1) | S675 | Uniprot |
| Q9Y698 (CACNG2) | T321 | Uniprot |
| Q9Y6G9 (DYNC1LI1) | S516 | Uniprot |
| Q9Y6W5 (WASF2) | S296 | Uniprot |
| Q9Y6W5 (WASF2) | S308 | Uniprot |
微信
微信
微信
微信
在线咨询
To Top